05-26-2021 HPB Agenda Packet
Historic Preservation Board
REGULAR MEETING AGENDA
Wednesday, May 26, 2021 | 5:00 PM
Virtual Zoom Meeting
CALL TO ORDER / ROLL CALL
This Historic Preservation Board (HPB) meeting is conducted via telecommunication and is
compliant with provisions of the Brown Act and Executive Order N-29-20 issued by the
Governor.
The following Board Members are listed to permit them to appear electronically or
telephonically at the Regular Historic Preservation Board meeting of April 28, 2021: Chair Mike
Foulkes, and Board Members Todd Walter, Susan Blake, and Laura Taylor Moore.
While members of the public will not be able to attend the meeting of the Campbell Historic
Preservation Board in person, the meeting will be live-streamed on YouTube at
https://www.youtube.com/user/CityofCampbell.
Interested persons may also register to electronically participate in the meeting via Zoom at
https://us02web.zoom.us/j/87372045817?pwd=cDVtRGF5SXJ1SytVK0IrN3BjTXVodz09. After
registering, you will receive a confirmation email. The complete agenda packet will be posted to
the City's Agenda Center website (http://bit.ly/campbellhpbagenda) by the Friday before the
Wednesday meeting. Please be advised that if you challenge the nature of the above project in
court, you may be limited to raising only those issues you or someone else raised at the Public
Hearing described in this Notice, or in written correspondence delivered to the City of Historic
Preservation Board at, or prior to, the Public Hearing by email to planning@campbellca.gov.
Questions may be addressed to Senior Planner Daniel Fama, Board Secretary, at (408) 866-2193
or danielf@campbellca.gov.
AGENDA MODIFICATIONS OR POSTPONEMENTS
Board Members or the Board Secretary may request that agenized items be considered in a
different order than shown in the agenda or be postponed to a subsequent meeting.
APPROVAL OF MINUTES
1. Approval of Minutes of April 28, 2021 (Roll Call Vote)
¾ Meeting Minutes, 4/28/2021
Historic Preservation Board Agenda for May 26, 2021 Pg. 2
ORAL COMMUNICATIONS
This portion of the meeting is reserved for individuals wishing to address the Board on matters
of community interest that are not listed on the agenda. In the interest of time, the Chair may
limit speakers to three minutes. Please be aware that State law prohibits the Board from acting
on non-agendized items, however, the Chair may refer matters to staff for follow-up.
BOARD/STAFF ANNOUNCEMENTS
Board Members and/or staff may make announcements on matters related to historic
preservation and promotion.
PUBLIC HEARINGS
2. Mills Act Contract Applications (73 S. 1st Street, 204 Alice Avenue, 51 Alice Avenue, and
81 Alice Avenue) (Resolution/Roll Call Vote)
Public Hearing to consider applications for Mills Act contracts for properties located at
73 S. 1st Street, 204 Alice Avenue, 51 Alice Avenue, and 81 Alice Avenue, commonly
known as the Laura Campbell Swope House, the William & Dorothy (Mills) Harrison
House, the Walter B. & Annie (Hall) Jones House, and the Doc and Cora Beal House,
respectively. Staff is recommending that this project be deemed Categorically Exempt
under CEQA. City Council meeting date to be determined. Project Planner: Daniel Fama,
Senior Planner
¾ Staff Report
OLD BUSINESS
3. Mills Act ad hoc Subcommittee Report and Program Update Discussion
The Subcommittee will provide a monthly update of its activities to the Board.
ADJOURNMENT
Adjourn to the next regularly scheduled Historic Preservation Board meeting of June 23, 2021,
at 5:00 PM to be conducted via Zoom.
Americans with Disabilities Act (ADA)
In compliance with the Americans with Disabilities Act, listening assistance devices are available
for meetings held in the Council Chambers. If you require accommodation to participate in the
meeting, please contact Corinne Shinn at the Community Development Department, at
corinnes@campbellca.gov or (408) 866-2140.
Historic Preservation Board
REGULAR MEETING MINUTES
tĞĚŶĞƐĚĂLJ, April 2ϴ, 2021 | 5:00 PM
Zoom Meeting
CALL TO ORDER
The Regular Historic Preservation Board meeting of $SULO 2021, was called to order
DW 5:00 p.m., via Zoom, by Chair Foulkes, and the following proceedings were had to
wit.
ROLL CALL
HPB Members Present: HPB Members Absent
Michael Foulkes, Chair None
Todd Walter, Vice Chair
Susan Blake
Laura Taylor Moore
Staff Members Present:
Daniel Fama, Senior Planner
Corinne Shinn, Recording Secretary
AGENDA MODIFICATIONS OR POSTPONEMENTS
None
APPROVAL OF MINUTES
1. Approval of Minutes of March 24, 2021.
Motion: Upon motion of Vice Chair Walter, seconded by Member Moore, the
Historic Preservation Board approved the minutes of the meeting of
March 24, 2021 with a minor correction on pages 11 and 12, by the
following roll call vote:
AYES: Blake, Foulkes, Moore, and Walter
NOES: None
ABSENT: None
Abstain: None
ORAL REQUESTS
None
Historic Preservation Board Minutes for April 28, 2021 (Regular Meeting) Page 2
BOARD AND STAFF ANNOUNCEMENTS
Chair Foulkes asked if there were any Board or Staff Announcements.
Planner Daniel Fama:
x Advised the Board that the City Council has continued its discussion on next year’s
budget including work plans. It remains to be seen if Council includes the Mills Act
Update as a work plan item for the HPB.
x Announced the selection of the new Community Development Director as Rob
Eastwood, who is currently Planning Manager for Santa Clara County. He will begin
work on June 1st.
PUBLIC HEARINGS
2.99 Alice Avenue – Tier 1 Historic Resource Alteration Permit (Resolution/Roll Call
Vote): Public Hearing to consider the application of Kohlsaat & Associates for a Tier
1 Historic Resource Alteration Permit (PLN-2021-58) to allow removal of two French
doors and an exterior chimney to be replaced with a new sliding glass door and to infill
one existing window, to an Alice Avenue Historic District property commonly known
as the Claude and Jeanette Grizzle House, located at 99 Alice Avenue in the R-1-6-
H (Single-family Residential / Historic Overlay) Combining Zoning District. Staff is
recommending that this project be deemed Categorically Exempt under CEQA.
Planner Daniel Fama provided the staff report.
Chair Foulkes asked if there were Board questions for staff.
Vice Chair Walter asked for verification that there are changes proposed to a permitted
addition done years ago.
Planner Daniel Fama replied correct.
Vice Chair Walter asked if the HPB approves a new addition to this structure, will that
addition become a part of the home that falls under the review purview of the HPB.
Planner Daniel Fama:
x Replied yes.
x Added that there is no distinction between original construction and new additions.
x Stated that there is some nuance to that as the most recent addition was accomplished
via a Conditional Use Permit.
x Said that moving forward, minor changes could be approved by staff.
x Pointed out that this one straddles between both the old and new Historic Ordinance.
Member Blake stated that the staff recommendation for this is appropriate.
Chair Foulkes opened the Public Hearing for Item 2.
Gary Kohlsaat, Project Applicant and Architect:
Historic Preservation Board Minutes for April 28, 2021 (Regular Meeting) Page 3
x Thanked Planner Daniel Fama and the members of the Historic Preservation Board
for their work on this application.
x Added that they had been caught off-guard that an HPB review would be required in
this case.
x Said they were confused why such review would be necessary for alterations to a
2015 addition.
x Advised that Planner Daniel Fama informed him that HPB review is require for homes
on Alice Avenue as it is an Historic District.
x Explained that they proposed to remove two sets of French doors and a fireplace that
is no longer desired by this owner.
x Added that these changes are at the rear of the home and would not be visible from
the public right-of-way/street.
x Opined that these changes are appropriate for this home and project and he hopes
that the HPB believes it is appropriate as well.
x Stated that his one topic for discussion is the proposed materials.
x Told the HPB that what he is proposing is not the typical aluminum windows. What
they will use costs more than a wood door. Its color will match the rest of the house
in a power-coated white.
x Assured that these are a higher standard material.
x Said that this addition was actually done with vinyl-clad wood windows. They are wood
windows clad with aluminum or vinyl that helps to preserve these doors/windows for
decades while presenting just a negligible difference in appearance.
Vice Chair Walter:
x Agreed that when this property processed an addition about five to six years ago, it
was agreed by HPB to allow for the use of vinyl-clad wood windows because there
was wood on the inside.
x Asked Mr. Kohlsaat if the new windows are Fleetwood.
Gary Kohlsaat, Applicant/Architect:
x Replied yes.
x Added that they are thermally broken to meet energy requirements.
Vice Chair Walter:
x Advised that Board that these Fleetwood windows/doors are costly windows. They are
great, last a long time and be very nice in appearance.
x Added that this is a nice project.
Chair Foulkes closed the Public Hearing for Item 2.
Member Moore:
x Said that HPB needs an updated photograph of 99 Alice Avenue for its DPR sheets.
x Pointed out that the current photo doesn’t reflect the 2015 changes.
Gary Kohlsaat, Applicant/Architect said that they could provide updated photographs of
the home for the DPR.
Planner Daniel Fama admitted that updates such as that are on a longer-term to-do list.
Historic Preservation Board Minutes for April 28, 2021 (Regular Meeting) Page 4
Chair Foulkes asked if there are any further Board comments on this item.
Vice Chair Walter said he is in favor of the project.
Member Blake added, “As am I”.
Member Moore said she is in approval with the project.
Planner Daniel Fama:
x Suggested that if the Board is in agreement, they should include in their motion for
approval striking the requirement for a future approval of window material and/or
identify the manufacturer of the proposed windows (Fleetwood).
Motion: Upon motion of Vice Chair Walter, seconded by Member Blake, the
Historic Preservation Board adopted Resolution 2021-05, approving a
Tier 1 Historic Resource Alteration Permit (PLN-2021-58) to allow
removal of two French doors and an exterior chimney to be replaced
with a new sliding glass door and to infill one existing window, to an
Alice Avenue Historic District property commonly known as the
Claude and Jeanette Grizzle House, located at 99 Alice Avenue, and
accepting the use of Fleetwood thermally broken system windows, by
the following roll call vote:
AYES: Blake, Foulkes, Moore, and Walter
NOES: None
ABSENT: None
Abstain: None
***
3.136 Alice Avenue – Tier 1 Historic Resource Alteration Permit (Resolution/Roll
Call Vote): Public Hearing to consider the application of Michael and Mary Ann
Escobar for a Tier 1 Historic Resource Alteration Permit (PLN-2021-47) to allow
modification and closure of existing side windows, installation of a rear patio door to
replace an existing window, partial removal of an existing chimney, formalize
previous installation of brick cladding and widening of an existing window in the space
of a former garage door that was removed as part of an unpermitted "garage
conversion," and to attach an existing rear trellis structure, to an Alice Avenue Historic
District property commonly known as the Ira & Mabel Abbott House, located at 136
Alice Avenue in the R-1-6-H (Single-family Residential / Historic Overlay) Combining
Zoning District. Staff is recommending that this project be deemed Categorically
Exempt under CEQA.
Planner Daniel Fama provided the staff report.
Chair Foulkes asked if there were Board questions for staff.
There were none.
Chair Foulkes asked if the applicant wants to take off the existing brick.
Historic Preservation Board Minutes for April 28, 2021 (Regular Meeting) Page 5
Planner Daniel Fama replied that they want to widen the window side to meet egress
standards and add a surround around it along with a small roof over that window for detail.
Chair Foulkes opened the Public Hearing for Item 3.
Mike Vierhus, Architect:
x Stated that Planner Daniel Fama did a good job presenting this project to the Board.
x Clarified that he has submitted updated elevations that show that the grids on all of
the windows will be matching.
Chair Foulkes closed the Public Hearing for Item 3.
Member Blake:
x Disclosed that she met with property owner, Mike Escobar, at his request.
x Added that she provided him with a copy of his home’s DPR form.
x Said that while he asked for her opinion, she looked at the home but offered no
opinions during the visit saving those feedback comments for tonight’s public meeting.
x Thanked architect Mike Vierhus for the latest design that is much clear of before and
after appearances. These changes unify and enhances the front façade, which at
present is awkward.
x Admitted that she is hoping a new front door is incorporated into this plan as the
current door is not too good.
Vice Chair Walter said he agrees with the proposed changes.
Member Moore said she is in agreement as well.
Motion: Upon motion of Vice Chair Walter, seconded by Member Blake, the
Historic Preservation Board adopted Resolution 2021-06, approving a
Tier 1 Historic Resource Alteration Permit (PLN-2021-47) to allow
modification and closure of existing side windows, installation of a
rear patio door to replace an existing window, partial removal of an
existing chimney, formalize previous installation of brick cladding and
widening of an existing window in the space of a former garage door
that was removed as part of an unpermitted "garage conversion," and
to attach an existing rear trellis structure, to an Alice Avenue Historic
District property commonly known as the Ira & Mabel Abbott House,
located at 136 Alice Avenue, by the following roll call vote:
AYES: Blake, Foulkes, Moore, and Walter
NOES: None
ABSENT: None
Abstain: None
***
Historic Preservation Board Minutes for April 28, 2021 (Regular Meeting) Page 6
4. 199 Alice Avenue – Tier 1 Historic Resource Alteration Permit (Resolution/Roll
Call Vote): Public Hearing to consider the application of Beckstrom Architecture for
a Tier 1 Historic Resource Alteration Permit (PLN-2020-116) to allow an
approximately 670 square-foot rear addition and to formalize an existing unpermitted
approximately 240 square-foot side enclosed patio addition, to an Alice Avenue
Historic District property commonly known as the Walker and Ethel Curry Vaughn
House, located at 199 Alice Avenue in the R-1-6-H (Single-family Residential /
Historic Overlay) Combining Zoning District. Staff is recommending that this project
be deemed Categorically Exempt under CEQA.
Planner Daniel Fama provided the staff report.
Chair Foulkes asked if there were Board questions for staff.
Vice Chair Walter:
x Explained that the proposed metal roof to the existing addition is used to allow for a
lower pitch room.
x Added that there are other options if the Board doesn’t like metal roofs.
Chair Foulkes asked what standing seam metal roof was.
Vice Chair Walter:
x Said that the proposed roof is metal roofing that has a standing seam.
x Added that the panels come together with these seams and those attached seams
seam to be stamped together.
x Admitted that it is a nice-looking roof not often seen in residential uses as it is
expensive.
x Stated that such a roof is more modern and/or ranch-style roofing material.
Planner Daniel Fama said that metal roofing is being seen more recently with Modern
Farmhouse architecture.
Member Blake asked when the original addition was built.
Planner Daniel said it is not entirely clear since it was done without permits.
Member Blake:
x Reiterated that that first addition was unpermitted.
x Admitted that it seems reasonable to approve the first addition together with the
proposed addition under consideration this evening.
x Stated that the original addition is not that large.
x Said that she has no issue with use of a metal roof here but questions its impact from
absorbing and retaining heat.
Chair Foulkes opened the Public Hearing for Item 4.
Historic Preservation Board Minutes for April 28, 2021 (Regular Meeting) Page 7
Eric Beckstrom, Applicant/Architect:
x Stated that he has used metal roofing before.
x Added that the appearance of this proposed metal roof does not present a
business/commercial appearing statement. A metal roof has a practical use.
x Provided the evolution of the structure(s) on this property at 199 Alice Avenue.
o Reported that the current detached garage was the original house constructed
in 1922 and used as a home for the first five years.
o Pointed out that what was being constructed along Alice Avenue at that time
were spec houses.
o Explained that the original owner of 199 Alice Avenue went on to do some spec
houses along Alice Avenue.
o Said that many architectural styles appear on this house. It is dynamic for that
reason.
x Stated that there are other unresolved things.
x Explained that a metal roof is actually better for repelling heat. It doesn’t absorb and
retain heat.
x Added that composition roofing does hold heat.
x Reported that he has used metal roofing on homes that he owns.
x Advised that the metal roof is not painted. It comes pre-painted and with a 40-year
guarantee.
x Recommended a good book for the Board to read, “Big House, Little House, Back
House, Barn”.
x Pointed out that this house at 199 Alice Avenue is the smallest house on the whole
block.
x Stated that with the changes, this home will be handsome and last another 100 years.
x Said that they have worked well with Planner Daniel Fama in reaching this proposal.
Everyone has been great.
Shelby Edwards, Property Owner, 199 Alice Avenue:
x Stated that she is happy to be here this evening with her project.
x Thanked the Board for its consideration.
Chair Foulkes closed the Public Hearing for Item 4.
Vice Chair Walter said that proposal has been well thought out and there are not a lot of
questions about it.
Motion: Upon motion of Vice Chair Walter, seconded by Member Blake, the
Historic Preservation Board adopted Resolution 2021-07, approving a
Tier 1 Historic Resource Alteration Permit (PLN-2020-116) to allow an
approximately 670 square-foot rear addition and to formalize an
existing unpermitted approximately 240 square-foot side enclosed
patio addition, to an Alice Avenue Historic District property commonly
known as the Walker and Ethel Curry Vaughn House, located at 199
Alice Avenue, by the following roll call vote:
AYES: Blake, Foulkes, Moore, and Walter
NOES: None
Historic Preservation Board Minutes for April 28, 2021 (Regular Meeting) Page 8
ABSENT: None
Abstain: None
Member Blake said that she enjoyed Eric’s presentation. Member Blake agreed.
***
OLD BUSINESS
5. Mills Act ad hoc Subcommittee Report and Program Update Discussion: The
Subcommittee will provide a monthly update of its activities to the Board.
Vice Chair Walter:
x Reported that he, Member Blake and Planner Daniel Fama prepared a scoring sheet
work for the review of the pending four properties to ensure an even playing field in
reviewing each one.
x Stated that the three of them need to sit down together and go through the ratings.
x Reminded that there are two Mills Act Contracts left available at this time and we have
four properties submitted for consideration.
Planner Daniel Fama:
x Said they should try to meet next week.
x Advised that for the next HPB meeting on May 26th, the whole Board will be looking at
four Mills Act Contract application packages in the same and fair manner.
x Added that the four addresses/applications will be heard as a single item on the
agenda. It makes more sense to discuss all four properties at the same time.
x Stated that after reviewing each property on its merits, the Board can then rank the
four properties from 1 to 4. The ranking should be incorporated into the formal
resolution that will be sent by HPB on to Council for final consideration and action.
Vice Chair Walter asked if there will be a sunset date for the two properties not selected
for future consideration. How would that work?
Planner Daniel Fama:
x Stated that is a question that the staff report prepared for Council can raise.
x Said that the properties ranked 1 and 2 would be sent onward to Council.
Chair Foulkes asked what if a property is found inadequate for a Mills Act Contract. Can
it be taken out of consideration by the Board?
Planner Daniel Fama:
x Said that if more than two properties are found to be warranted to receive a Mills Act
Contract, they can so designate and send those on to Council for consideration and
see if they are willing to grant just two or go ahead and approve more.
x Added that if a property is deemed by the Board as unwarranted of a Mills Act
Contract, reasoning for that decision would be incorporated into the resolution
forwarded by the Board on to Council. The basis for denial would need to be included.
Historic Preservation Board Minutes for April 28, 2021 (Regular Meeting) Page 9
Member Blake asked if it would be possible to provide a copy of the initial ranking and
draft worksheets to the other two members prior to the next HPB meeting.
Planner Daniel Fama:
x Replied yes.
x Said that he plans to provide the materials for the next meeting a week early as there
is a lot of material to review.
Chair Foulkes asked if the Boards review would need to conform with the existing
regulations rather the proposed that have not yet been approved and codified.
Planner Daniel Fama replied yes. He added that due to Council’s concentration on
budget preparation and adoption, the Council’s meeting date for the consideration of Mills
Act Contract assignments is as of yet unknown.
Member Moore asked if staff could provide the addresses that have applied.
Planner Daniel Fama:
x Listed the addresses for which applications have been received as:
o 51 Alice Avenue
o 81 Alice Avenue
o 204 Alice Avenue
o 72 S. First Street
Chair Foulkes asked if all applicants will be present at the HPB meeting on May 23rd.
Planner Daniel Fama replied yes, they will make their respective pitches for consideration
by the Board.
Vice Chair Walter asked what discretion there is for looking at things relating to use of the
existing Mills Act information available.
Planner Daniel Fama:
x Said that the Board must be using what we have in writing. Go with that as an
objective process.
x Added that the argument for economic need by any of the applicants should not be
considered as it isn’t possible to get sufficient financial information to use that issue in
a fair and objective manner.
x Stressed the need to ensure the Board to provide information on how it came to the
ranking positions.
Vice Chair Walter:
x Said that he only has a draft Mills Act application form dated from 2012.
x Asked that the most current application packet (or link) be provided to the HPB.
Historic Preservation Board Minutes for April 28, 2021 (Regular Meeting) Page 10
Planner Daniel Fama said that as the process is electronic through MGO (My Government
On-Line), he would send the members of the Board the link to the Mills Act application
packet.
Vice Chair Walter:
x Questioned whether an application can be rejected if the projects proposed as part of
a Mills Act submittal are not included on the list of allowable projects for use of Mills
Act funds.
Planner Daniel Fama:
x Said that he felt that it is inappropriate for staff to refuse a Mills Act request.
x Added that the HPB can decide if an application submitted should be unranked.
Member Blake recounted that Vice Chair Walter had been looking on the City’s website
to find the application materials.
Vice Chair Walter said he just found a single page and not the rest of the submittal
materials.
Planner Daniel Fama:
x Said he would update the Historic Preservation section of the website to provide
information required for electronic submittals of Mills Act Contracts applications.
x Explained that a Mills Act Contract application falls under “Minor-Miscellaneous”
category found within the MGO Planning submittal section.
x Reiterated that Council would formally consider whether to incorporate the Mills Act
Update into the next fiscal year’s work plan.
x Cautioned that due to budget concerns, that may end up being put on hold.
Vice Chair Walter clarified that the Council would consider the four Mills Act Contract
applications but may well hold off on updating the Mills Act Program itself.
Planner Daniel Fama reiterated that Council is at the point of formally discussing this.
ADJOURNMENT
Adjourned at 6:10 p.m. to the next Regular Historic Preservation Board meeting
scheduled for May 26, 2021, at 5:00 PM, using Zoom.
PREPARED BY: ______________________________________
Corinne Shinn, Recording Secretary
APPROVED BY: ______________________________________
Michael Foulkes, Chair
ATTEST: ______________________________________
Daniel Fama, HPB Staff Liaison
RESOLUTION NO. 2021-05
BEING A RESOLUTION OF THE HISTORIC PRESERVATION
BOARD OF THE CITY OF CAMPBELL RECOMMENDING
APPROVAL OF A TIER 1 HISTORIC RESOURCE ALTERATION
PERMIT (PLN-2021-58) TO ALLOW REMOVAL OF TWO FRENCH
DOORS AND AN EXTERIOR CHIMNEY TO BE REPLACED WITH A
NEW SLIDING GLASS DOOR AND TO INFILL ONE EXISTING
WINDOW, TO AN ALICE AVENUE HISTORIC DISTRICT
PROPERTY COMMONLY KNOWN AS THE CLAUDE AND
JEANETTE GRIZZLE HOUSE, LOCATED AT 99 ALICE AVENUE IN
THE R-1-6-H (SINGLE-FAMILY RESIDENTIAL / HISTORIC
OVERLAY) COMBINING ZONING DISTRICT. FILE NO: PLN-2021-
58.
After notification and public hearing, as specified by law and after presentation by the
Board Secretary, proponents and opponents, the hearing was closed.
The Historic Preservation Board finds as follows with regards to file number PLN-2021-58:
1. The Project Site is an approximately 11,000 square-foot single-family residential
property located on Alice Avenue, west of Third Street, within the Alice Avenue
Historic District.
2. The Project Site is zoned R-1-6-H (Single-Family Residential / Historic Preservation
Overlay) on the City of Campbell Zoning Map.
3. The Project Site is designated Low Density Residential on the City of Campbell
General Plan Land Use diagram.
4. The Project Site is developed with a single-family residence, a non-landmark historic
district resource constructed in 1924 in a Craftsman-influenced style, commonly
known as the Claude and Jeanette Grizzle House.
5. The Project Site was subject to two Conditional Use Permit approvals by the Planning
Commission, upon recommendations of the Historic Preservation Board, once in
2013 and again in 2015. These approvals allowed for a substantial addition and
alteration to the residence and construction of a detached accessory dwelling unit.
6. The Proposed Project is an application for a Tier 1 Historic Resource Alteration
Permit to allow removal of two French doors and an exterior chimney to be replaced
with a new sliding glass door and to infill one existing window. The proposed work
would be performed at the rear of the structure affecting the addition constructed in
2013-2015.
7. Campbell Municipal Code (CMC) Section 21.33.080 (Historic Resource Alteration
Permit (Tier 1)) requires that any alteration to a landmark or historic district property
be reviewed through a "Tier 1" Historic Resource Alteration Permit.
8. Pursuant to CMC Section 21.33.080, a request for an Historic Resource Alteration
Permit is considered by the Historic Preservation Board in a public hearing conducted
Historic Preservation Board Resolution No. 2021-05 Page 2 of 3
PLN-2021-58 ~ 99 Alice Avenue
in compliance with CMC Chapter 21.64. Upon conclusion of the public hearing, the
Board shall provide a recommendation for approval or denial to the decision-making
body.
9. A recommendation for approval by the Historic Preservation Board, based on the
ability to affirmatively establish the findings provided in CMC Section 21.33.080.C,
allows the issuance of a Zoning Clearance by the Community Development Director
in that the proposal would comply with all applicable standards and provisions for the
category of use in the zoning district of the subject parcel, as specified by CMC
Section 21.40.030.
10. The proposed project would be consistent with the following General Plan policies:
Policy LUT-8.1: Historic Buildings, Landmarks and Districts and Cultural Resources: Preserve,
rehabilitate or restore the City’s historic buildings, landmarks, districts and
cultural resources and retain the architectural integrity of established building
patterns within historic residential neighborhoods to preserve the cultural
heritage of the community.
Policy CNR-1.1: Historic Resource Preservation: Ensure that the City and its citizens preserve
historic resources as much as possible.
11. No substantial evidence has been presented which shows that the project, as
currently presented will have a significant adverse impact on the environment.
Based upon the foregoing findings of fact, the Historic Preservation Board further finds and
concludes that:
Historic Resource Alteration Permit – Tier 1 Findings (CMC Sec. 21.33.080):
1. The proposed action is consistent with the purposes of this chapter and the
applicable requirements of the Municipal Code;
2. The proposed action is consistent with the applicable design guidelines, including, but
not limited to, the Historic Design Guidelines for Residential Buildings;
3. The proposed action will not have a significant impact on the aesthetic, architectural,
cultural, or engineering interest or historical value of the historic resource or district;
4. The proposed action is consistent with the Secretary of the Interior's Standards, as
follows:
a. The proposed action will preserve and retain the historic character of the
historic resource and will be compatible with the existing historic features, size,
massing, scale and proportion, and materials.
b. The proposed action will, to the greatest extent possible, avoid removal or
significant alteration of distinctive materials, features, finishes, and spatial
relationships that characterize the historic resource.
Historic Preservation Board Resolution No. 2021-05 Page 3 of 3
PLN-2021-58 ~ 99 Alice Avenue
c. Deteriorated historic features will be repaired rather than replaced to the
greatest extent possible.
d. New additions will be differentiated from the historic resource and will be
constructed such that the essential form and integrity of the historic resource
shall be protected if the addition is removed in the future.
Environmental Findings (CMC Sec. 21.38.050):
5. This project is Categorically Exempt under Section 15301, Class 1, of the California
Environmental Quality Act (CEQA), pertaining to minor alterations to existing
structures.
THEREFORE, BE IT RESOLVED that the Historic Preservation Board recommends
approval of a Tier 1 Historic Resource Alteration (PLN-2021-58) to allow removal of two
French doors and an exterior chimney to be replaced with a new sliding glass door and to
infill one existing window, to an Alice Avenue Historic District property commonly known as
the Claude and Jeanette Grizzle House, located at 99 Alice Avenue, subject to the
attached Conditions of Approval (attached Exhibit “A”).
PASSED AND ADOPTED this 28th day of April, 2021, by the following roll call vote:
AYES: Board Members: Walter, Blake, Moore, and Foulkes
NOES: Board Members:
ABSENT: Board Members:
ABSTAIN: Board Members:
APPROVED:
Michael Foulkes, Chair
ATTEST:
Daniel Fama, Secretary
EXHIBIT A
CONDITIONS OF APPROVAL
Historic Resource Alteration Permit (PLN-2021-58)
Where approval by the Director of Community Development, City Engineer, Public
Works Director, City Attorney or Fire Department is required, that review shall be for
compliance with all applicable conditions of approval, adopted policies and guidelines,
ordinances, laws and regulations and accepted engineering practices for the item under
review. Additionally, the applicant is hereby notified that he/she is required to comply
with all applicable Codes or Ordinances of the City of Campbell and the State of
California that pertain to this development and are not herein specified.
COMMUNITY DEVELOPMENT DEPARTMENT
1. Approved Project: Approval is granted for a Tier 1 Historic Resource Alteration
Permit (PLN-2021-58) to allow removal of two French doors and an exterior chimney
to be replaced with a new sliding glass door and to infill one existing window, to an
Alice Avenue Historic District property commonly known as the Claude and Jeanette
Grizzle House, located at 99 Alice Avenue. The project shall substantially conform
to the Project Plans included as Attachment No. 6 in the April 28, 2021 Historic
Preservation Board Staff Report, except as may be modified by conditions of
approval contained herein.
2. Permit Expiration: The Tier 1 Historic Resource Alteration Permit approval shall be
valid for one year from the date of approval (expiring April 28, 2022). Within this
one-year period, an application for a building permit must be submitted. Failure to
meet this deadline or expiration of an issued building permit will result in the Historic
Resource Alteration Permit being rendered void.
3. Material(s): The new sliding door shall be a Fleetwood thermally broken sliding door
window system.
RESOLUTION NO. 2021-06
BEING A RESOLUTION OF THE HISTORIC PRESERVATION
BOARD OF THE CITY OF CAMPBELL RECOMMENDING
APPROVAL OF A TIER 1 HISTORIC RESOURCE ALTERATION
PERMIT (PLN-2021-47) TO ALLOW MODIFICATION AND
CLOSURE OF EXISTING SIDE WINDOWS, INSTALLATION OF A
REAR PATIO DOOR TO REPLACE AN EXISTING WINDOW,
PARTIAL REMOVAL OF AN EXISTING CHIMNEY, FORMALIZE
PREVIOUS INSTALLATION OF BRICK CLADDING AND
WIDENING OF AN EXISTING WINDOW IN THE SPACE OF A
FORMER GARAGE DOOR THAT WAS REMOVED AS PART OF
AN UNPERMITTED "GARAGE CONVERSION," AND TO ATTACH
AN EXISTING REAR TRELLIS STRUCTURE, TO AN ALICE
AVENUE HISTORIC DISTRICT PROPERTY COMMONLY KNOWN
AS THE IRA & MABEL ABBOTT HOUSE, LOCATED AT 136 ALICE
AVENUE IN THE R-1-6-H (SINGLE-FAMILY RESIDENTIAL /
HISTORIC OVERLAY) COMBINING ZONING DISTRICT. FILE NO.:
PLN-2021-47
After notification and public hearing, as specified by law and after presentation by the
Board Secretary, proponents and opponents, the hearing was closed.
The Historic Preservation Board finds as follows with regards to file number PLN-2021-47:
1. The Project Site is an approximately 8,800 square-foot single-family residential
property located on Alice Avenue, west of Third Street, within the Alice Avenue
Historic District.
2. The Project Site is zoned R-1-6-H (Single-Family Residential / Historic Preservation
Overlay) on the City of Campbell Zoning Map.
3. The Project Site is designated Low Density Residential on the City of Campbell
General Plan Land Use diagram.
4. The Project Site is developed with a Ranch-style single-family residence, a non-
landmark historic district resource constructed in 1938 commonly known as the Ira &
Mabel Abbott House.
5. The Proposed Project is an application for a Tier 1 Historic Resource Alteration
Permit to allow modification and closure of existing side windows, installation of a rear
patio door to replace an existing window, partial removal of an existing chimney,
formalize previous installation of brick cladding and widening of an existing window in
the space of a former garage door that was removed as part of an unpermitted
"garage conversion," and to attach an existing rear trellis structure.
6. Campbell Municipal Code (CMC) Section 21.33.080 (Historic Resource Alteration
Permit (Tier 1)) requires that any alteration to a landmark or historic district property
be reviewed through a "Tier 1" Historic Resource Alteration Permit.
Historic Preservation Board Resolution No. 2021-06 Page 2 of 5
PLN-2021-47 ~ 136 Alice Avenue
7. Pursuant to CMC Section 21.33.080, a request for an Historic Resource Alteration
Permit is considered by the Historic Preservation Board in a public hearing conducted
in compliance with CMC Chapter 21.64. Upon conclusion of the public hearing, the
Board shall provide a recommendation for approval or denial to the decision-making
body.
8. A recommendation for approval by the Historic Preservation Board, based on the
ability to affirmatively establish the findings provided in CMC Section 21.33.080.C,
allows the issuance of a Zoning Clearance by the Community Development Director
in that the proposal would comply with all applicable standards and provisions for the
category of use in the zoning district of the subject parcel, as specified by CMC
Section 21.40.030.
9. The Campbell Historic Design Guidelines provides the following four Preservation
Principals from which the decision-making process should be based:
a. Retain and preserve the historic character of a property. Do not try to make a
building look older than it is by introducing elements that do not match the
existing design. Mixing historical design elements can confuse the character
of a building. If it is necessary to remove significant materials and
architectural features, it is important to remove them carefully and refurbish
them so they can be reincorporated into the finished project. If the elements
must be replaced it is recommended that similar methods and materials be
used so the replacement elements closely match the original.
b. Preserve distinctive features and examples of craftsmanship. Construction
techniques or distinctive finishes that characterize an historic property should
be treated carefully and maintained in order to prevent the need for
replacement or alteration. Most often these features will be comprised of
windows, doors, porches, ornamentation, or other features, which are
typically seen by the public.
c. New additions or exterior alterations should respect the historic integrity of
the property and its environment. Any new construction should not destroy
historic materials that characterize the property, and it should be compatible
with the historic architectural features.
d. Deteriorated historic features should be repaired rather than replaced. When
repairs are not possible, a historic feature should be replaced with a new
feature matching the old in design and, where possible, materials.
10. The Secretary of the Interior's Standards for Rehabilitation provides the following
standards from which alterations to historical buildings shall be evaluated against:
a. A property shall be used for its historic purpose or be placed in a new use
that requires minimal change to the defining characteristics of the building
and its site and environment.
Historic Preservation Board Resolution No. 2021-06 Page 3 of 5
PLN-2021-47 ~ 136 Alice Avenue
b. The historic character of a property shall be retained and preserved. The
removal of historic materials or alteration of features and spaces that
characterize a property shall be avoided.
c. Each property shall be recognized as a physical record of its time, place, and
use. Changes that create a false sense of historical development, such as
adding conjectural features or architectural elements from other buildings,
shall not be undertaken.
d. Most properties change over time; those changes that have acquired historic
significance in their own right shall be retained and preserved.
e. Distinctive features, finishes, and construction techniques or examples of
craftsmanship that characterize a property shall be preserved.
f. Deteriorated historic features shall be repaired rather than replaced. Where
the severity of deterioration requires replacement of a distinctive feature, the
new feature shall match the old in design, color, texture, and other visual
qualities and, where possible, materials. Replacement of missing features
shall be substantiated by documentary, physical, or pictorial evidence.
g. Chemical or physical treatments, such as sandblasting, that cause damage
to historic materials shall not be used. The surface cleaning of structures, if
appropriate, shall be undertaken using the gentlest means possible.
h. Significant archeological resources affected by a project shall be protected
and preserved. If such resources must be disturbed, mitigation measures
shall be undertaken.
i. New additions, exterior alterations, or related new construction shall not
destroy historic materials that characterize the property. The new work shall
be differentiated from the old and shall be compatible with the massing, size,
scale, and architectural features to protect the historic integrity of the
property and its environment.
j. New additions and adjacent or related new construction shall be undertaken
in such a manner that if removed in the future, the essential form and
integrity of the historic property and its environment would be unimpaired.
11. The Proposed Project incorporates brick material, which respects the historic integrity
of the property and is compatible with the historic architectural features of the home.
12. The Proposed Project, as conditioned, would incorporate new windows consistent
with the Design Guidelines "recommended practices".
13. The Proposed Project may formalize past conversion of the attached garage because
a detached garage is present on the property.
14. The Proposed Project may allow attachment of a trellis structure because the
attachment will not adversely affect the historic resource.
Historic Preservation Board Resolution No. 2021-06 Page 4 of 5
PLN-2021-47 ~ 136 Alice Avenue
15. The Proposed Project may be found consistent with the following General Plan
policies:
Policy CNR-1.1: Historic Resource Preservation: Ensure that the City and its citizens preserve
historic resources as much as possible.
Strategy LUT-5.2a: Neighborhood Compatibility: Promote new residential development and
substantial additions that are designed to maintain and support the existing
character and development pattern of the surrounding neighborhood,
especially in historic neighborhoods and neighborhoods with consistent
design characteristics.
Policy LUT-8.1: Historic Buildings, Landmarks and Districts and Cultural Resources: Preserve,
rehabilitate or restore the City’s historic buildings, landmarks, districts and
cultural resources and retain the architectural integrity of established building
patterns within historic residential neighborhoods to preserve the cultural
heritage of the community.
Policy LUT-20.1b: Building Patterns: Ensure that new development is designed to blend in with
the existing building patterns of the neighborhood. For example, if the majority
of the garages on the street are at the rear of the site, the new building should
be designed to accommodate a rear garage.
16. No substantial evidence has been presented which shows that the project, as
currently presented, will have a significant adverse impact on the environment.
Based upon the foregoing findings of fact, the Historic Preservation Board further finds and
concludes that:
Historic Resource Alteration Permit – Tier 1 Findings (CMC Sec. 21.33.080):
1. The proposed action is consistent with the purposes of this chapter and the
applicable requirements of the Municipal Code;
2. The proposed action is consistent with the applicable design guidelines, including, but
not limited to, the Historic Design Guidelines for Residential Buildings;
3. The proposed action will not have a significant impact on the aesthetic, architectural,
cultural, or engineering interest or historical value of the historic resource or district;
4. The proposed action is consistent with the Secretary of the Interior's Standards, as
follows:
a. The proposed action will preserve and retain the historic character of the
historic resource and will be compatible with the existing historic features, size,
massing, scale and proportion, and materials.
b. The proposed action will, to the greatest extent possible, avoid removal or
significant alteration of distinctive materials, features, finishes, and spatial
relationships that characterize the historic resource.
c. Deteriorated historic features will be repaired rather than replaced to the
greatest extent possible.
Historic Preservation Board Resolution No. 2021-06 Page 5 of 5
PLN-2021-47 ~ 136 Alice Avenue
d. New additions will be differentiated from the historic resource and will be
constructed such that the essential form and integrity of the historic resource
shall be protected if the addition is removed in the future.
Environmental Findings (CMC Sec. 21.38.050):
5. This project is Categorically Exempt under Section 15301, Class 1, of the California
Environmental Quality Act (CEQA), pertaining to minor alterations to existing
structures.
THEREFORE, BE IT RESOLVED that the Historic Preservation Board recommends
approval of a Tier 1 Historic Resource Alteration Permit (PLN-2021-47) to allow
modification and closure of existing side windows, installation of a rear patio door to
replace an existing window, partial removal of an existing chimney, formalize previous
installation of brick cladding and widening of an existing window in the space of a former
garage door that was removed as part of an unpermitted "garage conversion," and to
attach an existing rear trellis structure, to an Alice Avenue Historic District property
commonly known as the Ira & Mabel Abbott House, located at 136 Alice Avenue, subject
to the attached Conditions of Approval (attached Exhibit “A”).
PASSED AND ADOPTED this 28th day of April, 2021, by the following roll call vote:
AYES: Board Members: Walter, Blake, Moore, and Foulkes
NOES: Board Members:
ABSENT: Board Members:
ABSTAIN: Board Members:
APPROVED:
Mike Foulkes, Chair
ATTEST:
Daniel Fama, Secretary
EXHIBIT A
CONDITIONS OF APPROVAL
Historic Resource Alteration Permit (PLN-2021-47)
Where approval by the Director of Community Development, City Engineer, Public
Works Director, City Attorney or Fire Department is required, that review shall be for
compliance with all applicable conditions of approval, adopted policies and guidelines,
ordinances, laws and regulations and accepted engineering practices for the item under
review. Additionally, the applicant is hereby notified that he/she is required to comply
with all applicable Codes or Ordinances of the City of Campbell and the State of
California that pertain to this development and are not herein specified.
COMMUNITY DEVELOPMENT DEPARTMENT
Planning Division
1. Approved Project: Approval is granted for a Tier 1 Historic Resource Alteration
Permit (PLN-2021-47) to allow modification and closure of existing side windows,
installation of a rear patio door to replace an existing window, partial removal of an
existing chimney, formalize previous installation of brick cladding and widening of an
existing window in the space of a former garage door that was removed as part of an
unpermitted "garage conversion," and to attach an existing rear trellis structure, to
an Alice Avenue Historic District property commonly known as the Ira & Mabel
Abbott House, located at 136 Alice Avenue. The project shall substantially conform
to the Project Plans included as Attachment No. 5 in the April 28, 2021 Historic
Preservation Board Staff Report, except as may be modified by conditions of
approval contained herein.
2. Permit Expiration: The Tier 1 Historic Resource Alteration Permit approval shall be
valid for one year from the date of approval (expiring April 28, 2022). Within this one-
year period, an application for a building permit must be submitted. Failure to meet
this deadline or expiration of an issued building permit will result in the Historic
Resource Alteration Permit being rendered void.
3. Window/Door Material: New doors and windows shall be made of a high-quality
material consistent with the Campbell Historic Design Guidelines as determined by
the Community Development Director, specifically excluding vinyl or aluminum.
4. Rough Framing and Planning Final Required: Planning Division clearance is
required prior to rough framing and final Building Permit clearance. Construction not
in substantial compliance with the approved project plans shall not be approved
without prior authorization of the necessary approving body.
5. Minor Modifications: Minor Modifications to the approved project plans are subject to
review and approval by the Community Development Director pursuant to CMC
Section 21.56.060 (Amendments to an approved project).
6. Fences/Walls: Except as noted below, any newly proposed fencing and/or walls
shall comply with Campbell Municipal Code Section 21.18.060 and shall be
submitted for review and approval by the Community Development Department.
Exhibit A - Conditions of Approval ~ 136 Alice Ave. (PLN-2021-47) Page 2
7. On-Site Lighting: On-site lighting shall be shielded away from adjacent properties
and directed on site. The design and type of lighting fixtures and lighting intensity of
any proposed exterior lighting for the project shall be reviewed and approved by the
Community Development Director prior to installation of the lighting for compliance
with all applicable Conditions of Approval, ordinances, laws and regulations. Lighting
fixtures shall be of a decorative design to be compatible with the residential
development and shall incorporate energy saving features.
8. Contractor Contact Information Posting: The project site shall be posted with the
name and contact number of the lead contractor in a location visible from the public
street prior to the issuance of building permits.
9. Construction Activities: The applicant shall abide by the following requirements
during construction:
a. The project site shall be posted with the name and contact number of the lead
contractor in a location visible from the public street prior to the issuance of
building permits.
b. Construction activities shall be limited to weekdays between 8:00 a.m. and
5:00 p.m. and Saturdays between 9:00 a.m. and 4:00 p.m. No construction
shall take place on Sundays or holidays unless an exception is granted by the
Building Official.
c. All construction equipment with internal combustion engines used on the
project site shall be properly muffled and maintained in good working
condition.
d. Unnecessary idling of internal combustion engines shall be strictly prohibited.
e. All stationary noise-generating construction equipment, such as air
compressors and portable power generators, shall be located as far as
possible from noise-sensitive receptors such as existing residences and
businesses.
f. Use standard dust and erosion control measures that comply with the
adopted Best Management Practices for the City of Campbell.
Building Division:
11. Permit Required: A building permit application shall be required for the proposed
project. The building permit shall include Electrical/Plumbing/Mechanical fees when
such work is part of the permit.
12. Conditions of Approval: The Conditions of Approval shall be stated in full on the
cover sheet of construction plans submitted for building permit.
RESOLUTION NO. 2021-07
BEING A RESOLUTION OF THE HISTORIC PRESERVATION
BOARD OF THE CITY OF CAMPBELL RECOMMENDING
APPROVAL OF A TIER 1 HISTORIC RESOURCE ALTERATION
PERMIT (PLN-2020-116) TO ALLOW AN APPROXIMATELY 670
SQUARE-FOOT REAR ADDITION AND TO FORMALIZE AN
EXISTING UNPERMITTED APPROXIMATELY 240 SQUARE-FOOT
SIDE ENCLOSED PATIO ADDITION, TO AN ALICE AVENUE
HISTORIC DISTRICT PROPERTY COMMONLY KNOWN AS THE
WALKER AND ETHEL CURRY VAUGHN HOUSE, LOCATED AT
199 ALICE AVENUE IN THE R-1-6-H (SINGLE-FAMILY
RESIDENTIAL / HISTORIC OVERLAY) COMBINING ZONING
DISTRICT. FILE NO.: PLN-2020-116
After notification and public hearing, as specified by law and after presentation by the
Board Secretary, proponents and opponents, the hearing was closed.
The Historic Preservation Board finds as follows with regards to file number PLN-2020-
116:
1. The Project Site is an approximately 7,375 square-foot single-family residential
property located on Alice Avenue, between First and Third Streets, within the Alice
Avenue Historic District.
2. The Project Site is zoned R-1-6-H (Single-Family Residential / Historic Preservation
Overlay) on the City of Campbell Zoning Map.
3. The Project Site is designated Low Density Residential on the City of Campbell
General Plan Land Use diagram.
4. The Project Site is developed with a single-family residence, a non-landmark historic
district resource constructed in 1927 in a vernacular style, commonly known as the
Walker and Ethel Curry Vaughn House.
5. The Proposed Project is an application for a Tier 1 Historic Resource Alteration
Permit to allow an approximately 670 square-foot rear addition and to formalize an
existing unpermitted approximately 240 square-foot side enclosed patio addition.
6. Campbell Municipal Code (CMC) Section 21.33.080 (Historic Resource Alteration
Permit (Tier 1)) requires that any alteration to a landmark or historic district property
be reviewed through a "Tier 1" Historic Resource Alteration Permit.
7. Pursuant to CMC Section 21.33.080, a request for an Historic Resource Alteration
Permit is considered by the Historic Preservation Board in a public hearing conducted
in compliance with CMC Chapter 21.64. Upon conclusion of the public hearing, the
Board shall provide a recommendation for approval or denial to the decision-making
body.
8. A recommendation for approval by the Historic Preservation Board, based on the
ability to affirmatively establish the findings provided in CMC Section 21.33.080.C,
Historic Preservation Board Resolution No. 2021-07 Page 2 of 5
PLN-2020-116 ~ 199 Alice Avenue
allows the issuance of a Zoning Clearance by the Community Development Director
in that the proposal would comply with all applicable standards and provisions for the
category of use in the zoning district of the subject parcel, as specified by CMC
Section 21.40.030.
9. The Campbell Historic Design Guidelines provides the following four Preservation
Principals from which the decision-making process should be based:
a. Retain and preserve the historic character of a property. Do not try to make a
building look older than it is by introducing elements that do not match the
existing design. Mixing historical design elements can confuse the character
of a building. If it is necessary to remove significant materials and
architectural features, it is important to remove them carefully and refurbish
them so they can be reincorporated into the finished project. If the elements
must be replaced it is recommended that similar methods and materials be
used so the replacement elements closely match the original.
b. Preserve distinctive features and examples of craftsmanship. Construction
techniques or distinctive finishes that characterize an historic property should
be treated carefully and maintained in order to prevent the need for
replacement or alteration. Most often these features will be comprised of
windows, doors, porches, ornamentation, or other features, which are
typically seen by the public.
c. New additions or exterior alterations should respect the historic integrity of
the property and its environment. Any new construction should not destroy
historic materials that characterize the property, and it should be compatible
with the historic architectural features.
d. Deteriorated historic features should be repaired rather than replaced. When
repairs are not possible, a historic feature should be replaced with a new
feature matching the old in design and, where possible, materials.
10. The Secretary of the Interior's Standards for Rehabilitation provides the following
standards from which alterations to historical buildings shall be evaluated against:
a. A property shall be used for its historic purpose or be placed in a new use
that requires minimal change to the defining characteristics of the building
and its site and environment.
b. The historic character of a property shall be retained and preserved. The
removal of historic materials or alteration of features and spaces that
characterize a property shall be avoided.
c. Each property shall be recognized as a physical record of its time, place, and
use. Changes that create a false sense of historical development, such as
adding conjectural features or architectural elements from other buildings,
shall not be undertaken.
Historic Preservation Board Resolution No. 2021-07 Page 3 of 5
PLN-2020-116 ~ 199 Alice Avenue
d. Most properties change over time; those changes that have acquired historic
significance in their own right shall be retained and preserved.
e. Distinctive features, finishes, and construction techniques or examples of
craftsmanship that characterize a property shall be preserved.
f. Deteriorated historic features shall be repaired rather than replaced. Where
the severity of deterioration requires replacement of a distinctive feature, the
new feature shall match the old in design, color, texture, and other visual
qualities and, where possible, materials. Replacement of missing features
shall be substantiated by documentary, physical, or pictorial evidence.
g. Chemical or physical treatments, such as sandblasting, that cause damage
to historic materials shall not be used. The surface cleaning of structures, if
appropriate, shall be undertaken using the gentlest means possible.
h. Significant archeological resources affected by a project shall be protected
and preserved. If such resources must be disturbed, mitigation measures
shall be undertaken.
i. New additions, exterior alterations, or related new construction shall not
destroy historic materials that characterize the property. The new work shall
be differentiated from the old and shall be compatible with the massing, size,
scale, and architectural features to protect the historic integrity of the
property and its environment.
j. New additions and adjacent or related new construction shall be undertaken
in such a manner that if removed in the future, the essential form and
integrity of the historic property and its environment would be unimpaired.
11. The Proposed Project would clearly differentiate the new addition from the existing
residence through an increased height and use of horizontal siding (contrasting with
existing stucco).
12. The Proposed Project would also differentiate the existing enclosed patio addition
from the existing residence through installation of new standing seam metal roofing,
which will provide a material contrast.
13. The Proposed Project does not require any covered parking stalls because the
previous garage structure will be formally converted to an accessory dwelling unit.
14. The Proposed Project may be found consistent with the following General Plan
policies:
Policy CNR-1.1: Historic Resource Preservation: Ensure that the City and its citizens preserve
historic resources as much as possible.
Strategy LUT-5.2a: Neighborhood Compatibility: Promote new residential development and
substantial additions that are designed to maintain and support the existing
character and development pattern of the surrounding neighborhood,
Historic Preservation Board Resolution No. 2021-07 Page 4 of 5
PLN-2020-116 ~ 199 Alice Avenue
especially in historic neighborhoods and neighborhoods with consistent
design characteristics.
Policy LUT-8.1: Historic Buildings, Landmarks and Districts and Cultural Resources: Preserve,
rehabilitate or restore the City’s historic buildings, landmarks, districts and
cultural resources and retain the architectural integrity of established building
patterns within historic residential neighborhoods to preserve the cultural
heritage of the community.
Policy LUT-20.1b: Building Patterns: Ensure that new development is designed to blend in with
the existing building patterns of the neighborhood. For example, if the majority
of the garages on the street are at the rear of the site, the new building should
be designed to accommodate a rear garage.
15. No substantial evidence has been presented which shows that the project, as
currently presented, will have a significant adverse impact on the environment.
Based upon the foregoing findings of fact, the Historic Preservation Board further finds and
concludes that:
Historic Resource Alteration Permit – Tier 1 Findings (CMC Sec. 21.33.080):
1. The proposed action is consistent with the purposes of this chapter and the
applicable requirements of the Municipal Code;
2. The proposed action is consistent with the applicable design guidelines, including, but
not limited to, the Historic Design Guidelines for Residential Buildings;
3. The proposed action will not have a significant impact on the aesthetic, architectural,
cultural, or engineering interest or historical value of the historic resource or district;
4. The proposed action is consistent with the Secretary of the Interior's Standards, as
follows:
a. The proposed action will preserve and retain the historic character of the
historic resource and will be compatible with the existing historic features, size,
massing, scale and proportion, and materials.
b. The proposed action will, to the greatest extent possible, avoid removal or
significant alteration of distinctive materials, features, finishes, and spatial
relationships that characterize the historic resource.
c. Deteriorated historic features will be repaired rather than replaced to the
greatest extent possible.
d. New additions will be differentiated from the historic resource and will be
constructed such that the essential form and integrity of the historic resource
shall be protected if the addition is removed in the future.
Historic Preservation Board Resolution No. 2021-07 Page 5 of 5
PLN-2020-116 ~ 199 Alice Avenue
Environmental Findings (CMC Sec. 21.38.050):
5. This project is Categorically Exempt under Section 15301, Class 1, of the California
Environmental Quality Act (CEQA), pertaining to minor alterations to existing
structures.
THEREFORE, BE IT RESOLVED that the Historic Preservation Board approves a Tier 1
Historic Resource Alteration Permit (PLN-2020-116) to allow an approximately 670
square-foot rear addition and to formalize an existing unpermitted approximately 240
square-foot side enclosed patio addition, to an Alice Avenue Historic District property
commonly known as the Walker and Ethel Curry Vaughn House, located at 199 Alice
Avenue, subject to the attached Conditions of Approval (attached Exhibit “A”).
PASSED AND ADOPTED this 28th day of April, 2021, by the following roll call vote:
AYES: Board Members: Walter, Blake, Moore, and Foulkes
NOES: Board Members:
ABSENT: Board Members:
ABSTAIN: Board Members:
APPROVED:
Mike Foulkes, Chair
ATTEST:
Daniel Fama, Secretary
EXHIBIT A
CONDITIONS OF APPROVAL
Historic Resource Alteration Permit (PLN-2020-116)
Where approval by the Director of Community Development, City Engineer, Public
Works Director, City Attorney or Fire Department is required, that review shall be for
compliance with all applicable conditions of approval, adopted policies and guidelines,
ordinances, laws and regulations and accepted engineering practices for the item under
review. Additionally, the applicant is hereby notified that he/she is required to comply
with all applicable Codes or Ordinances of the City of Campbell and the State of
California that pertain to this development and are not herein specified.
COMMUNITY DEVELOPMENT DEPARTMENT
Planning Division
1. Approved Project: Approval is granted for a Tier 1 Historic Resource Alteration
Permit (PLN-2020-116) to allow an approximately 670 square-foot rear addition and
to formalize an existing unpermitted approximately 243 square-foot side enclosed
patio addition, to an Alice Avenue Historic District property commonly known as the
Walker and Ethel Curry Vaughn House, located at 199 Alice Avenue. The project
shall substantially conform to the Project Plans included as Attachment No. 4 in the
April 28, 2021 Historic Preservation Board Staff Report, except as may be modified
by conditions of approval contained herein.
2. Permit Expiration: The Tier 1 Historic Resource Alteration Permit approval shall be
valid for one year from the date of approval (expiring April 28, 2022). Within this one-
year period, an application for a building permit must be submitted. Failure to meet
this deadline or expiration of an issued building permit will result in the Historic
Resource Alteration Permit being rendered void.
3. Window/Door Material: New doors and windows shall be made of a high-quality
material consistent with the Campbell Historic Design Guidelines as determined by
the Community Development Director, specifically excluding vinyl or aluminum.
4. Rough Framing and Planning Final Required: Planning Division clearance is
required prior to rough framing and final Building Permit clearance. Construction not
in substantial compliance with the approved project plans shall not be approved
without prior authorization of the necessary approving body.
5. Minor Modifications: Minor Modifications to the approved project plans are subject to
review and approval by the Community Development Director pursuant to CMC
Section 21.56.060 (Amendments to an approved project).
6. Fences/Walls: Except as noted below, any newly proposed fencing and/or walls
shall comply with Campbell Municipal Code Section 21.18.060 and shall be
submitted for review and approval by the Community Development Department.
7. Water Efficient Landscape Standards: As a remodel/addition/rehabilitation
project with a total project landscape area equal to or less than 2,500 square
feet, this project is subject to the landscaping and irrigation standards in Chapter
Exhibit A - Conditions of Approval ~ 119 Alice Ave. (PLN-2020-116) Page 2
21.26 of the Campbell Municipal Code. The building permit application submittal
shall include compliant Planting and Irrigation Plans and shall include the following:
a. A completed Landscape Information Form.
b. A note on the Cover Sheet in minimum 1/2” high lettering stating “Planning
Final Required. The new landscaping indicated on the plans must be installed
prior to final inspection. Changes to the landscaping plan require Planning
approval.”
8. On-Site Lighting: On-site lighting shall be shielded away from adjacent properties
and directed on site. The design and type of lighting fixtures and lighting intensity of
any proposed exterior lighting for the project shall be reviewed and approved by the
Community Development Director prior to installation of the lighting for compliance
with all applicable Conditions of Approval, ordinances, laws and regulations. Lighting
fixtures shall be of a decorative design to be compatible with the residential
development and shall incorporate energy saving features.
9. Contractor Contact Information Posting: The project site shall be posted with the
name and contact number of the lead contractor in a location visible from the public
street prior to the issuance of building permits.
10. Construction Activities: The applicant shall abide by the following requirements
during construction:
a. The project site shall be posted with the name and contact number of the lead
contractor in a location visible from the public street prior to the issuance of
building permits.
b. Construction activities shall be limited to weekdays between 8:00 a.m. and
5:00 p.m. and Saturdays between 9:00 a.m. and 4:00 p.m. No construction
shall take place on Sundays or holidays unless an exception is granted by the
Building Official.
c. All construction equipment with internal combustion engines used on the
project site shall be properly muffled and maintained in good working
condition.
d. Unnecessary idling of internal combustion engines shall be strictly prohibited.
e. All stationary noise-generating construction equipment, such as air
compressors and portable power generators, shall be located as far as
possible from noise-sensitive receptors such as existing residences and
businesses.
f. Use standard dust and erosion control measures that comply with the
adopted Best Management Practices for the City of Campbell.
Building Division:
11. Permit Required: A building permit application shall be required for the proposed
project. The building permit shall include Electrical/Plumbing/Mechanical fees when
such work is part of the permit.
Exhibit A - Conditions of Approval ~ 119 Alice Ave. (PLN-2020-116) Page 3
12. Conditions of Approval: The Conditions of Approval shall be stated in full on the
cover sheet of construction plans submitted for building permit.
PUBLIC WORKS DEPARTMENT
The scope of this project triggers the requirement for Frontage Improvements as
required by Campbell Municipal Code 11.24.040. The applicant will be required to apply
for an Encroachment permit to construct frontage improvements as listed below. The
building permit and grading permit will not be issued until all Public Works Conditions of
Approval have been satisfied.
13. Storm Drain Area Fee: Prior to issuance of any grading or building permits for the
site, the applicant shall pay the required Storm Drain Area fee, currently set at
$2,120.00 per net acre, which is $352.77.
14. Pavement Restoration: The applicant shall restore the pavement in compliance with
City standard requirements. In the event that the roadway has recently received a
pavement treatment or reconstruction, the project will be subject to the City’s Street
Cut Moratorium. The applicant will be required to perform enhanced pavement
restoration consistent with the restoration requirements associated with the Street
Cut Moratorium. The City’s Pavement Maintenance Program website
(https://www.ci.campbell.ca.us/219) has detailed information on the streets currently
under moratorium and the enhanced restoration requirements.
15. Street Improvement Agreements / Plans / Encroachment Permit / Fees / Deposits:
Prior to issuance of any grading or building permits for the site, the applicant shall
execute a street improvement agreement, cause plans for public street
improvements to be prepared by a registered civil engineer, pay various fees and
deposits, post security and provide insurance necessary to obtain an encroachment
permit for construction of the standard public street improvements, as required by
the City Engineer. The plans shall include the following, unless otherwise approved
by the City Engineer:
a. Removal of existing driveway apron and necessary sidewalk, curb and gutter.
b. Construction of new driveway apron. The new driveway apron can be
combined with the existing adjacent driveway apron on 209 Alice Avenue with
the agreement of the property owner on 209 Alice Avenue. The applicant
shall coordinate with the 209 Alice Avenue property owner. If an agreement
can’t be reached, then the separation (bump) between the two driveway
aprons shall be reconstructed.
c. Removal and reconstruction of broken curb.
d. Construction of conforms to existing public and private improvements, as
necessary.
16. Street Improvements Completed for Occupancy and Building Permit Final: Prior to
allowing occupancy and/or final building permit signoff for any and/or all buildings,
the applicant shall have the required street improvements installed and accepted by
the City, and the design engineer shall submit as-built drawings to the City.
Exhibit A - Conditions of Approval ~ 119 Alice Ave. (PLN-2020-116) Page 4
17. Maintenance of Landscaping: Owner(s), current and future, are required to maintain
the landscaped park strip in the public right of way. This includes, but is not limited
to: lawn, plantings, irrigation, etc. Street trees shall not be pruned by the property
owner.
Item No. 2
CITY OF CAMPBELL ∙ HISTORIC PRESERVATION BOARD
Staff Report ∙ May 26, 2021
PLN-2021-26
PLN-2021-32
PLN-2021-49
PLN-2021-72
Public Hearing to consider applications for Mills Act contracts for
properties located at 73 S. 1st Street, 204 Alice Avenue, 51 Alice Avenue,
and 81 Alice Avenue, commonly known as the Laura Campbell Swope
House, the William & Dorothy (Mills) Harrison House, the Walter B. &
Annie (Hall) Jones House, and the Doc and Cora Beal House, respectively.
STAFF RECOMMENDATION
That the Historic Preservation Board review the submitted Mills Act contract applications and take
the following action:
1. Adopt a Resolution (reference Attachment 5) recommending that the City Council approve
up to two (2) Mills Act contract requests and deny the remaining requests.
ALTERNATIVES
The Historic Preservation Board may also take the following actions:
2. Adopt a Resolution (reference Attachment 6) recommending that the City Council deny all
of the Mills Act contract requests.
OR
3. Make a Motion to continue the public hearing to June 23, 2021; and, if applicable, direct the
applicant(s) to submit revised and/or additional documentation for further consideration.
ENVIRONMENTAL DETERMINATION
Staff recommends that the Historic Preservation Board recommend to the City Council that
approval of a Mills Act contract is exempt from the provisions of the California Environmental
Quality Act (CEQA) in that a Mills Act contract is not a "project" as defined by Public Resources
Code Section 21065. CEQA specifically excludes organizational or administrative activities of
government that will not result in direct or indirect physical change in the environment pursuant
to CEQA Guidelines Section 15378. Moreover, it can be anticipated that any work performed
pursuant to a Mills Act contract will itself be categorically exempt under Section 15331, Class 31
of the CEQA Guidelines, pertaining to projects involving the maintenance, rehabilitation,
restoration, preservation, or reconstruction of historical resources.
BACKGROUND
On October 4, 2011, the City Council adopted Resolution No. 11334, initiating a three-year pilot
Mills Act Incentive Program, allowing up to five (5) Mills Act contracts to assist property owners
of locally-designated historic residences to benefit from property tax savings in exchange for
reinvestment towards the structures’ preservation. During this three-year period, the City Council
authorized three (3) Mills Act contracts.
Staff Report – Historic Preservation Board Meeting of May 26, 2021 Page 2 of 7
Mills Act Contract Applications (Spring 2021)
On February 3, 2015, the City Council adopted Resolution No. 11776, approving an extension of
the Mills Act Incentive Program, allowing a combined maximum of ten (10) Mills Act contracts
over the course of the program. To date, the City has entered into eight (8) contracts, leaving a
maximum of two (2) additional contracts to be approved under the current program.
DISCUSSION
The following four Mills Act applications have been received, listed in order the applications were
accepted (date payment was posted). Due to the coincidental timing of these applications, staff
determined that it would be appropriate for all four to be considered concurrently by the Board.
Application No. 1 (51 Alice Avenue)
Property Owner: James Barrese
Property Address: 51 Alice Avenue (click link for a map)
Common Name: Walter B. & Annie Jones House
HRI Designation: Historic District
Construction Date: 1920
Architectural Style: Pre-War (non-distinct style)
Application Date (Fees Paid): 2/19/2021
Application File No.: PLN-2021-32
Submitted Materials:
¾ Attachment 1(a) - Priority Consideration Worksheet
¾ Attachment 1(b) - Proposed Schedule and Plan
¾ Attachment 1(c) - Prop. Tax Adjustment Worksheet
¾ Attachment 1(d) - DPR Primary Record Form
¾ Attachment 1(e) - City Permit History
¾ Attachment 1(f) - Property Photographs
¾ Attachment 1(g) - Project Plans (reference only)
¾ Attachment 1(h) - Written Statement
Application No. 2 (73 S. 1st Street)1
Property Owner: Chung Chan
Property Address: 73 S. 1st Street (click link for a map)
Common Name: Laura Campbell Swope House
HRI Designation: Landmark
Construction Date: 1895
Architectural Style: Queen Anne Victorian
Application Date (Fees Paid): 3/02/2021
Application File No.: PLN-2021-26
¾ Attachment 2(a) - Priority Consideration Worksheet
¾ Attachment 2(b) - Proposed Schedule and Plan
¾ Attachment 2(c) - Prop. Tax Adjustment Worksheet
¾ Attachment 2(d) - DPR Primary Record Form
¾ Attachment 2(e) - City Permit History
¾ Attachment 2(f) - Property Photographs
¾ Attachment 2(g) - Project Plans (reference only)
1 An earlier Mills Act contract application for this property was reviewed by the Board on 10/24/18 without the
applicant present and was subsequently withdrawn.
Staff Report – Historic Preservation Board Meeting of May 26, 2021 Page 3 of 7
Mills Act Contract Applications (Spring 2021)
Application No. 3 (204 Alice Avenue)
Property Owner: Kornel Kovacs
Property Address: 204 Alice Avenue (click link for a map)
Common Name: William & Dorothy Harrison House
HRI Designation: Historic District
Construction Date: 1940/1941
Architectural Style: Colonial Revival
Application Date (Fees Paid): 3/11/2021
Application File No.: PLN-2021-49
¾ Attachment 3(a) - Priority Consideration Worksheet
¾ Attachment 3(b) - Proposed Schedule and Plan
¾ Attachment 3(c) - Prop. Tax Adjustment Worksheet
¾ Attachment 3(d) - DPR Primary Record Form
¾ Attachment 3(e) - City Permit History
¾ Attachment 3(f) - Property Photographs
¾ Attachment 3(g) - Project Plans (reference only)
¾ Attachment 3(h) - Receipts and Invoices
Application No. 4 (81 Alice Avenue)
Property Owner: Douglas and Rebecca Fournier
Property Address: 81 Alice Avenue (click link for a map)
Common Name: Doc and Cora Beal House
HRI Designation: Historic District
Construction Date: 1926
Architectural Style: California Bungalow
Application Date (Fees Paid): 4/13/2021
Application File No.: PLN-2021-72
¾ Attachment 4(a) - Priority Consideration Worksheet
¾ Attachment 4(b) - Proposed Schedule and Plan
¾ Attachment 4(c) - Prop. Tax Adjustment Worksheet
¾ Attachment 4(d) - DPR Primary Record Form
¾ Attachment 4(e) - City Permit History
¾ Attachment 4(f) - Property Photographs
¾ Attachment 4(g) - Project Plans (reference only)
¾ Attachment 4(h) - Written Statement
These applications were submitted following the City's Mills Act Historic Property Tax Incentive
Program application package (reference Attachment 7). The application package requires
submittal of the three supplemental forms listed, below, which are included for each application
as sub-attachments (a), (b), and (c).
¾ Priority Consideration Worksheet (Supplemental Form #1): This form asks the
applicant to explain how their application will satisfy the established selection criteria
(discussed on the following page).
¾ Proposed Schedule and Plan (Supplemental Form #2): This worksheet asks the
applicant to identify proposed work, type of work (e.g., maintenance, remodel, etc.) the
year(s) in which the work will commence and be completed, and estimated cost.
¾ Property Tax Adjustment Worksheet (Supplemental Form #3): This worksheet asks
the applicant to complete a property tax savings estimate.
Staff Report – Historic Preservation Board Meeting of May 26, 2021 Page 4 of 7
Mills Act Contract Applications (Spring 2021)
The City's general application checklist asks for additional materials, including photographs and
plans, which are also included for each application submittal. Some applicants also provided
additional documentation including invoices/receipts and written descriptions. Staff additionally
included a permit history and DPR Primary Record Form for each property. The Board should take
into account all the information included with this report, public testimony that will be provided
during the public hearing, as well as any additional documentation that may be provided ahead of
or during the May 26th Board meeting, in its review. Please note that staff did not provided
feedback to the applicants regarding the adequacy of their submitted materials so as not to unduly
influence the review process.
ANALYSIS
The City Council resolution establishing the Mills Act program did not provide specific guidance
as to how applications should be reviewed other than consistency with the criteria for listing on
the Historic Resource Inventory (HRI). As such, the Board prepared its own selection criteria,
which is included on Page 3 of the Mills Act application package and restated on the Priority
Consideration Worksheet (Supplemental Form #1). Although the criteria references "ranking" of
applications, the Board has not performed this exercise before since previously there have been
more available contracts than applications.
Therefore, to facilitate the ranking and recommendation of the four submitted applications, staff
and the Mills Act ad hoc Subcommittee recommend that the Board apply a weighted point system
to the selection criteria, restated, below, such that up to five points (0-5) could be granted for
Criteria No. 1, No. 2, and No. 4 each, and up to one point for Criteria No. 5.2 An application could
receive up to 16 points using this methodology. For the Board's reference, staff has prepared a
ranking matrix, included as Attachment 8, which can be used to perform the ranking exercise.
The Board's consensus as to the two (2) applications with the highest ranking would be
recommended for approval to the City Council.
x Criteria No. 1 (5 points): A higher ranking will be given to those applications that
demonstrate that entering into a Mills Act Historic Property Contract will result in the
greatest number or value of improvements to the historic property thereby resulting in the
greatest benefit to the public.
x Criteria No. 2 (5 points): A higher ranking will be given to those applications that
demonstrate that entering into a Mills Act Historic Property Contract will substantially
reduce the threat to the historic property of demolition, deterioration, abandonment, and/or
general neglect.
x Criteria No. 3 (1 point): A higher ranking will be given to those applications that
demonstrate, in cases of economic hardship, that entering into a Mills Act Historic Property
Contract will result in the preservation and maintenance of a historic property.
x Criteria No. 4 (5 points): A higher ranking will be given to those applications that
demonstrate the highest percentage of tax savings being used to finance the property
maintenance and improvements.
2 Staff and the Mills Act Mills Act ad hoc Subcommittee discussed using the "Draft Ranking System – Contract
Selection Criteria" referenced at the previous Board meeting. However, this system heavily prioritizes homes that
are more historically significant rather than how property tax savings can be reinvested into a property.
Staff Report – Historic Preservation Board Meeting of May 26, 2021 Page 5 of 7
Mills Act Contract Applications (Spring 2021)
To provide a greater degree of objectivity in review of the applications, staff has also prepared a
comparison table, included as Attachment 9 that identifies the proposed work, proposed cost3,
estimated property tax savings4 (annual and over a 10-year period5), and the percentage of savings
reinvested into the property (cost ÷ savings) for each application. This information can be used to
evaluate the applications with regard to Criteria No. 1 (number and/or value of improvements)
and No. 4 (percentage of tax savings used to finance improvements).
Staff and the Mills Act ad hoc Subcommittee recommend that only proposed work be considered
in evaluation of the submitted applications. As such, the comparison table purposely excludes
work already performed, which is listed on several of the applicants' Proposed Schedule and
Plans. Although the Mills Act application package does not specifically address work already
performed, given the program limitations, it is reasonable for the remaining contracts to be
restricted to those that will result in the greatest amount of new investment into a property.
The comparison table also excludes work not listed as eligible on Form #2 of the Mills Act
application package, such as landscaping improvements. However, it does include bathroom and
kitchen remodels since those projects, although not specifically listed on Form #2 are effectively
allowable through inclusion of constituent remodeling work, such as cabinetry, electrical,
plumbing, and flooring.
With regard to Criteria No. 4 (percentage of tax savings used to finance improvements), staff also
suggests that for greater consistency points be granted based on a numerical spectrum at 10%
intervals:
x 90%-100% of savings reinvested = 5 points
x 80%-89% of savings reinvested = 4 points
x 70%-79% of savings reinvested = 3 points
x 60%-69% of savings reinvested = 2 points
x 50%-59% of savings reinvested = 1 point
x <49% than savings reinvested = 0 points
Conditions of Approval
If the Board is able to make a recommendation for approval on one or two of the applications, the
Board should also discuss any conditions of approval (beyond the standard requirements) it may
wish to recommend. For example, the Board may require submittal of an inspection report to
confirm the need for certain improvements/repairs or contractor estimates to substantiate the cost
of specific projects. The Board's recommendation may also incorporate specific requirements to
ensure material or design appropriateness in furtherance of the Campbell Historic Design
Guidelines.
The Board may also consider recommending a specific contract duration. As currently structured,
the City's Mills Act contracts have a minimum 10-year duration and automatically renew for one
additional year annually. If the Board wishes to limit the contract to the minimum 10-year duration
it may recommend that the City Council include a condition of approval directing the Community
Development Director to issue a Notice of Non-Renewal upon execution of the contract. The
Mills Act contract(s) would then expire in 2031.
3 The cost for reoccurring maintenance proposed at a specified interval is counted more than once as appropriate.
4 The savings is based on the applicant's estimate as provided in the Property Tax Adjustment Worksheet. The actual
reduced property tax will be calculated by the County Assessor's Office.
5 Since Mills Act contracts have a minimum 10-year duration, a 10-year contract period was assumed.
Staff Report – Historic Preservation Board Meeting of May 26, 2021 Page 6 of 7
Mills Act Contract Applications (Spring 2021)
ALTERNATIVES
Th Board is not obligated to come to a decision in a single meeting. If additional time is desired,
the Board may make a motion to continue the public hearing. The Board may also continue the
hearing if it desires additional information from one or more of the applicants before rendering a
decision. If the public hearing is to be continued, the Board may continue it to the next regular
meeting of June 23rd (given legal noticing requirements a special meeting cannot be scheduled).
If the Board determines that none of the applications warrant a Mills Act contract, it may elect to
make recommendation to the Council to deny all of the applications by referencing Attachment
6 (Draft Resolution - Deny All). This action would retain the two available Mills Act contracts
for use by other properties in the future.
NEXT STEPS
Following a recommendation by the Board, a City Council public hearing will be scheduled. The
Council may accept or reject the Board's recommendation in whole or in part. The Council may
also elect to refer the applications back to the Board for further consideration if one or more of
the applicants submit additional and/or revised information not previously considered.
If the Council approves a Mills Act application(s), staff will work with the applicant(s) to confirm
completion of any conditions of approval before a contract is executed by the City Manager.
Additionally, since three of the subject properties are located in the Alice Avenue Historic District
and one is a landmark, any exterior alteration itemized in the Mills Act contract will require
subsequent approval of a Historic Resource Alteration Permit, which would be considered by the
Board.
ATTACHMENTS
Application No. 1 (51 Alice Avenue) Documents:
¾ Attachment 1(a) - Priority Consideration Worksheet
¾ Attachment 1(b) - Proposed Schedule and Plan
¾ Attachment 1(c) - Prop. Tax Adjustment Worksheet
¾ Attachment 1(d) - DPR Primary Record Form
¾ Attachment 1(e) - City Permit History
¾ Attachment 1(f) - Property Photographs
¾ Attachment 1(g) - Project Plans (reference only)
¾ Attachment 1(h) - Written Statement
Application No. 2 (73 S. 1st Street) Documents:
¾ Attachment 2(a) - Priority Consideration Worksheet
¾ Attachment 2(b) - Proposed Schedule and Plan
¾ Attachment 2(c) - Prop. Tax Adjustment Worksheet
¾ Attachment 2(d) - DPR Primary Record Form
¾ Attachment 2(e) - City Permit History
¾ Attachment 2(f) - Property Photographs
¾ Attachment 2(g) - Project Plans (reference only)
Staff Report – Historic Preservation Board Meeting of May 26, 2021 Page 7 of 7
Mills Act Contract Applications (Spring 2021)
Application No. 3 (204 Alice Avenue):
¾ Attachment 3(a) - Priority Consideration Worksheet
¾ Attachment 3(b) - Proposed Schedule and Plan
¾ Attachment 3(c) - Prop. Tax Adjustment Worksheet
¾ Attachment 3(d) - DPR Primary Record Form
¾ Attachment 3(e) - City Permit History
¾ Attachment 3(f) - Property Photographs
¾ Attachment 3(g) - Project Plans (reference only)
¾ Attachment 3(h) - Receipts and Invoices
Application No. 4 (81 Alice Avenue)
¾ Attachment 4(a) - Priority Consideration Worksheet
¾ Attachment 4(b) - Proposed Schedule and Plan
¾ Attachment 4(c) - Prop. Tax Adjustment Worksheet
¾ Attachment 4(d) - DPR Primary Record Form
¾ Attachment 4(e) - City Permit History
¾ Attachment 4(f) - Property Photographs
¾ Attachment 4(g) - Project Plans (reference only)
¾ Attachment 4(h) - Written Statement
Additional Attachments
¾ Attachment 5 - Draft Resolution (Approval)
¾ Attachment 6 - Draft Resolution (Deny All)
¾ Attachment 7 - Mills Act Application Package (for reference)
¾ Attachment 8 - Priority Consideration Worksheet Ranking Matrix
¾ Attachment 9 – Application Comparison Table
Prepared by:
Daniel Fama, Senior Planner
APPLICATION SUPPLEMENTAL FORM #1
Priority Consideration Worksheet
The following four criteria are used by the Historic Preservation Board (HPB) to evaluate each contract application and to
prioritize and rank them. Please use this form to explain why or how your historic resource and residential property
should be considered a priority.
A higher ranking will be given to those applications that demonstrate that entering into a Mills Ace Historic Property
Contract will result in the greatest number or value of improvements to the historic resource and property thereby
resulting in the greatest benefit to the public.
Explain what improvements are proposed for the historic resource and property and how you believe that
completing those improvements will be a public benefit:
I originally chose to live on Alice Avenue because of the beauty of the entire street. Each home lends its
individual style to the collective appeal of The Alice Avenue Historic District. Now that I’ve been here for several
years and have learned some of the histories of my own and neighboring houses, I’ve grown to appreciate just
how one structure can become so important to the whole.
I’ve grown to love my home and it’s nearly perfect location, but find that is suffering from the effects of old age
and somewhat of disrepair by previous owners. When I first moved into the home, invested in making significant
improvements to the home, and I addressed some foundation and significant dry rot issues. However, I am
continuing to find issues that come up do to the fact that older homes take a significant amount of work to
maintain, as well as upgrading them for modern living standards of comfort. There are design and age-related
maintenance issues that need to be addressed with my home. The only outward change I intend to bring to my
home is replacement of the missing enclosed front porch, which I hope will actually bring it back to a more
original historic look and feel.
When I consider the rehabilitation of 51 Alice Avenue and its natural beauty, I feel that is my obligation in
owning a historic home to maintain it to the highest level possible, as its dilapidation could become a blight to
the neighborhood. And although I intend to live on Alice Avenue for many years, the next owner may not be as
diligent as I am willing to be.
The general improvements are to interior and exterior lighting and electrical systems, plumbing and drainage
systems, HVAC systems, replacement of some exterior doors that have interior doors in place. The house is also
very drafty, and the temperature varies significantly though the house. It also needs insulation in many areas of
the home. I will also repair newly discovered external dry rot, repaint, repair or replace windows, carry out
regular inspections to keep up with unforeseen projects and replace the roof. I would like to upgrade the home
to modern efficiency standards. All of these projects will improve the home’s appearance, safety and ensure the
home lives its full life of another 100 years.
A higher ranking will be given to those applications that demonstrate that entering into a Mills Act Historic Property
Contract will substantially reduce the threat to the historic resource and property demolition, deterioration,
abandonment, and/or general neglect.
Explain the physical state of the historic resource and property and how you believe the proposed
improvements will prevent the demolition, deterioration, abandonment and general neglect of the historic
resource and property:
The outward appearance of 51 Alice Avenue is very good. However, as stated above, the house has some
problems.
Attachment 1(a)
x By inspecting the house every 3 years overall and for termite infestations, hidden problems can beaddresses
before much if any damage is caused.
x By adding a drainage system, pooling of water around the foundation can prevent foundation and dryrot
damage./ŚĂǀĞĂůƌĞĂĚLJŚĂĚƚŽŚĂǀĞƐŝŐŶŝĨŝĐĂŶƚĨŽƵŶĚĂƚŝŽŶƌĞƉĂŝƌƐĂŶĚƐƚƌĂƉƉŝŶŐĨƌŽŵƉƌŝŽƌĐƌĂĐŬŝŶŐ͘
x /ƌĞĐĞŶƚůLJĚŝƐĐŽǀĞƌĞĚƚŚĂƚƚŚĞŚŽŵĞŚĂƐƵŶƐĂĨĞůĞǀĞůƐŽĨƌĂĚŽŶŐĂƐ͘ZĂĚŽŶŐĂƐŝƐƌĂĚŝŽĂĐƚŝǀĞĂŶĚĐĂŶĐĂƵƐĞůƵŶŐ
ĐĂŶĐĞƌ͘dŚĞŚŽŵĞŚĂƐĂĨŝŶŝƐŚĞĚďĂƐĞŵĞŶƚƚŚĂƚǁĂƐƉƵƚŝŶďLJƉƌĞǀŝŽƵƐŽǁŶĞƌƐ͕ǁŚŝĐŚŝƐǁŚĞƌĞƚŚĞŐĂƐŝƐ
ĞŶƚĞƌŝŶŐƚŚĞŚŽŵĞ͘ƚƚŝŵĞƐ͕ƚŚĞŐĂƐůĞǀĞůŝŶƚŚĞŚŽƵƐĞŝƐĂďŽǀĞ WƐĂĨĞŚĞĂůƚŚůŝŵŝƚƐ͘dŚŝƐƉƌŽďůĞŵŶĞĞĚƐ
ƌĞŵĞĚŝĂƚŝŽŶƚŽŵĂŬĞƚŚĞŚŽŵĞƐĂĨĞƚŽĐŽŶƚŝŶƵĞƚŽůŝǀĞŝŶ͘
x By thoroughly addressing lighting and electrical system shortcomings, the reduction in unintended fire is
greatly improved.
x Older brickwork and concrete is cracking and needs repair, sealing, and possible replacement.
x By installing Ting (brand name for electrical problem surveillance), installing a leak detection system,replacing
exterior doors with the correct type and using a full house monitoring system, break-ins, theft,burglary and
fire can be deterred or prevented.
x By removing existing dry rot and repainting, it helps to protect the home from further damage.
x The HVAC and insulation items annotated above will greatly increase the “livability” factor of the home,which
will help me and future owners to ensure its stature and standing on the street.
x Historic windows are still in the house but they are very drafty and single-pane windows. I want toexplore
solutions for improving the insulation and stop the drafts, as well as fix the broken sashcounterweight
mechanisms. I want to find a way to solve this while preserving the original uniquenessof the beautiful
window design patterns and preserve the original glass that is still in the windows.
x Previously, I had to repair and strap parts of the cracked foundation. There are parts of the foundationthat
have not been accessible and have not been inspected that I expect need repair.
A higher ranking will be given to those application that demonstrate, in cases of economic hardship, that entering into
a Mills Act Historic Property Contract will result in the preservation and maintenance of a historic resource property.
Explain how you believe you have, or qualify as having, an economic hardship:
I am gradually stepping into retirement. I left my full-time job in 2016. My income was reduced at that time and
I now work part time. I hope to stop working part-time in a few years. I need to reduce my annual expenditures
to do this, but I also would like to continue to maintain and invest in 51 Alice Avenue. Having a Mills Act Historic
Property Contract will enable me to continue investing in the property regardless of my working or income
status post retirement.
A higher ranking will be given to those application that demonstrate the highest percentage of the tax saving being
used to finance the property maintenance and improvements.
Describe what percentage of the estimated tax savings you intent to reinvest into the property and structure
to finance the improvements.
It is my intention to spend 100% of any and all monies saved, with the addition of further funds to restore,
maintain, and improve 51 Alice Avenue. The projects noted are large and like with any old home, they may be
recurring every 10 to 15 years.
Supplemental Form #2
Work Task Type of Work
Year
Commenced
Year
Completed
Annual
Y/N
Estimated
Cost
Alarm System & Camera System
Live operator, Camera
Expansion, & Cloud
Recording 2020 ongoing Y $600.00
Light blocking curtains / window
treatments for upstairs bedrooms
which get too much light for
people to sleep
Window Treatment
Company 2021 2021 N $1,500.00
Improved interior lighting and LED
energy efficient lighting. Replace
older fixtures that are not dimming
compatible with modern
replacement LED bulbs Electrician 2021 2021 N $1,500.00
Kitchen cabinets repair and slam
prevention Handyman 2021 2021 N $300.00
Gutter cleaning Specialty 2021 ongoing Y $200.00
Dry rot repair and painting touch-
up. Painting/carpentry 2021 2021 N $1,250.00
Historically appropriate solution
for sun beating on the front
door. The doorknob gets so hot it
can give a burn (I measured 142F in
August which can cause 2nd
degree burns in a few seconds).
HPB please provide
guidance and/or
recommendations 2021 2021 N $5,500.00
Termite inspection (every three
years) Exterminator 2021 2021 N $750.00
Home Inspection (every three
years) Specialty Home
Inspection Company 2021 2021 N $600.00
HVAC and Heater regular
maintenance HVAC 2021 ongoing Y $450.00
Kitchen sink counter sealing/
potential replacement restoration. Tile Installer/plumber 2021 2021 N $2,000.00
Install ceiling fan(s) in bedrooms Electrician 2021 2021 N $1,750.00
Lawn and yard maintenance &
seasonal repair and maintenance Mow and Blow 2021 ongoing Y $5,200.00
Water Filtration system and
potential soft water system to
protect pipes Plumber 2021 2021 N $4,500.00
Re-insulation and sound-proofing
from Winchester Ave street noise
(Exterior sound-reduction as old
walls let in the noise from
Winchester and an adjacent gas
station) Specialist contractor 2022 2022 N $6,000.00
Attachment 1(b)
New drainage system to protect
the house: water pools under the
back patio and water near a
foundation is not good for long-
term integrity. I would like to do
drain pipes all the way to the
gutter or robust French drains. Landscaping 2022 2022 N $15,000.00
New ducts for the central
heating/AC. Currently, the ducts
lose about 25-30% of pressure due
to a leak in the system. HVAC 2022 2022 N $6,000.00
Arborist Tree trimming. Removal
of a dead tree and replanting Tree
Remover/Landscaper 2022 2022 N $3,000.00
Sealing of basement: it’s very
drafty and the doors need to be
replaced from inside doors to
outside doors
Window/door
specialist 2022 2022 N $3,100.00
Water Leak Detector for Basement
Sump Pump, Water Heater, and
HVAC System Handyman 2023 2023 N $500.00
Sidewalk repair and front gutter
repair Concrete/specialty 2023 2023 N $2,500.00
Restoration Repair work and
potential improved insulations
solution for original sash windows. Window specialist 2023 2023 N $7,590.00
Fence replacement Fence Company 2023 2023 N $15,000.00
Attic: Re-insulation of house (attic
and underfloor) General Contractor 2023 2023 N $7,700.00
Installation of Attic ventilation
units for summer heat removal General Contractor 2023 2023 N $4,100.00
Restoration of a mini-driveway and
gate Landscaping 2024 2024 N $7,500.00
Front yard landscaping project Landscaping 2024 2024 N $15,000.00
Backyard landscaping project, brick
repair, restoration Landscaping 2024 2024 N $22,000.00
Upstairs cubby room: Fix low door
entry with new door work, and add
HVAC to the room
HVAC/Window
installer 2024 2024 N $3,650.00
HVAC/Heating Solution for 3-levels
of the home. Temperature
differentials across the three levels
of the house are a challenge during
extremely hot and extremely cold
days. It needs to be addressed to
make the house comfortable. HVAC 2025 2025 N $7,000.00
Addressing, excavating, sealing the
“dirt room” floor in the basement. Carpenter 2026 2026 N unknown
Concrete repair, replacement, and
brick repair and brick wall
repair/replacement
Driveway
concrete/paver/mason
specialty companies 2026 2026 N $15,000.00
Exterior re-painting, calking and
sealing Painter 2028 2028 N $15,000.00
Interior re-painting and repair
work Painter/carpenter 2028 2028 N $12,000.00
Backup generator / power solution
for power outages Electrician 2028 2028 N $20,000.00
Roof maintenance and a new roof
in approximately 5-10 years (my
handyman told me he made some
repairs but it will need to have
work done then.) Roofing 2029 2029 N $29,000.00
ZĂĚŽŶĂďĂƚĞŵĞŶƚƐLJƐƚĞŵƚŽ
ŵŝƚŝŐĂƚĞƵŶŚĞĂůƚŚLJůĞǀĞůƐŽĨƌĂĚŽŶ
ŐĂƐŝŶƚŚĞŚŽƵƐĞ
^ƉĞĐŝĂůƚLJůŝĐĞŶƐĞĚƌĂĚŽŶ
ĂďĂƚĞŵĞŶƚĨŝƌŵ ϮϬϮϭ ϮϬϮϭ N $ϭϯ,000.00
Attachment 1(c)
DPR 523A (1/95) *Required information
Page 1 of 2 *Resource Name or #: Walter B. and Annie Hall Jones House P1. Other Identifier: Campbell Historic District Property
*P2. Location: Not for Publication _ Unrestricted *a. County Santa Clara and (P2c, P2e, and P2b or P2d. Attach a Location Map as necessary.) *b. USGS 7.5' Quad Date T; R ; ¼ of ¼ of Sec ; B.M. c. Address 51 Alice Ave. City Campbell Zip 95008 d. UTM: (Give more than one for large and/or linear resources) Zone , mE/ mN e. Other Locational Data: (e.g., parcel #, directions to resource, elevation, etc., as appropriate) APN: 412-05-066 *P3a. Description: (Describe resource and its major elements. Include design, materials, condition, alterations, size, setting, and boundaries) Historic Single-Family Residence. This two-story pre-fabricated house is semi-bungalow in style, with craftsman style influence. Constructed of wood, with shingled roofing, it contains the characteristic front gabled roof, shed dormer type upper windows and exterior glass panes in upper portions. Front door entrance is rectangular, with projecting lintel, and inset glass panes. The original house contained an enclosed front porch, which was altered to install upper dormer windows around 1940-50. A rear porch was also added after 1939, when the building was sold to the McLaughlin Family. *P3b. Resource Attributes: (List attributes and codes) 02- Single Family Residence
*P4. Resources Present: _ Building Structure Object Site District Element of District
Other (Isolates, etc.)
P5b. Description of Photo: (view,
date, accession #) Front
Façade, 07/09/07
*P6. Date Constructed/Age and
Source: _ Historic
Prehistoric
Both 1920 *P7. Owner and Address: Patrick and Chris Fitzgerald (April 1987) *P8. Recorded by: (Name, affiliation, and address) Peggy Coats City of Campbell 70 N. First St. *P9. Date Recorded: March 1986 *P10. Survey Type: (Describe) *P11. Report Citation: (Cite survey report and other sources, or enter "none.") Interview with Marion Jones Trowbridge, owner’s daughter by Thomas King (March 8, 1978). 1979 Santa Clara Country Historic Resources Inventory, p.30, no.4. Initial survey notes compiled by Hugh I. Schade(October 8, 1977).
*Attachments: NONE Location Map Continuation Sheet _ Building, Structure, and Object Record
Archaeological Record District Record Linear Feature Record Milling Station Record Rock
Art Record
Artifact Record Photograph Record Other (List):
State of California — The Resources Agency Primary #
DEPARTMENT OF PARKS AND RECREATION HRI #
PRIMARY RECORD Trinomial
NRHP Status Code
Other Listings
Review Code Reviewer Date
P5a. Photograph or Drawing (Photograph required for buildings, structures, and objects.)
Attachment 1(d)
DPR 523A (1/95) *Required information
*NRHP Status Code
Page 2 of 2 *Resource Name or # (Assigned by recorder)
B1. Historic Name: none known
B2. Common Name: Walter B. and Annie Hall Jones House
B3. Original Use: Single-Family Home B4. Present Use: Same
*B5. Architectural Style: Pre World War II Housing (non distinct style)
*B6. Construction History: (Construction date, alterations, and date of alterations)
Built, 1920. Rear porch added after 1939, when the house was sold to the McLaughlin Family.
Upper dormer windows installed 1940-50.
*B7. Moved? _ No Yes Unknown Date: Original Location:
*B8. Related Features:
B9a. Architect: (Aladdin “pre-cut” home) b. Builder: Self-assembled by
original owners
*B10. Significance: Theme Economic/Industrial, Architecture Area
Period of Significance Property Type
Applicable Criteria
(Discuss importance in terms of historical or architectural context as defined by theme, period,
and geographic scope. Also address integrity.)
Alice Avenue was created in 1915 on a portion of the site of the fruit drying yards owned by
the George E. Hyde Company, a canning and fruit dehydrating plant occupying 17 acres in
Campbell. The land was originally owned and utilized by Flamming’s Fruit Dryer (1887); sold
to Frank Buxton’s Dryer (1890, and again sold to Campbell Fruit Grower’s Union (1892) which
owned and controlled the drying yards and packing house until its sale to George Hyde in
1909. The residential subdivision, “Hyde Residential Park” was built primarily for housing
cannery workers, though George and Alice Hyde (the Street’s namesake) resided there too.
The house is an Aladdin pre-cut house, purchased in 1917 during World War I when lumber for
building was scarce. The house arrived, and was assembled in 1920. It is an excellent example
of pre-fabricated construction housing of a semi-bungalow. Walter Brewster Jones, the
original owner, was a bookkeeper/office manager for George Hyde Company, later the Sunsweet
Corporation, in Campbell.
B11. Additional Resource Attributes: (List attributes and codes)
*B12. References:
See P11
B13. Remarks:
*B14. Evaluator: See P8
*Date of Evaluation: See P9
State of California — The Resources Agency Primary #
DEPARTMENT OF PARKS AND RECREATION HRI#
BUILDING, STRUCTURE, AND OBJECT RECORD
(This space reserved for official comments.)
Attachment 1 (e)
Attachment 1(f)
Attachment 1(g)
First Floor Plan
Basement Floor Plan
Second Floor Plan
Garage & Workshop Floor Plan
CITY OF CAMPBELL MILLS ACT PROPERTY TAX INCENTIVE PROGRAM
APPLICATION FORM
Submit to City of Campbell Planning Division, 70 N. First Street, Campbell, CA 95008 (408) 866-2140
Applicant/Owner/Agent (same)
Applicant: James Barrese, 51 Alice Avenue, Campbell, CA 95008
Phone: 408-839-7969 Email: ũĂŵĞƐͺďĂƌƌĞƐĞΛLJĂŚŽŽ͘ĐŽŵ
Project Location
Street: 51 Alice Avenue Assessor’s Parcel Number: 412-05-006
Project Description
This project is for the updating, repair and rehabilitation of the Walter B & Annie Hall Jones house located in the Alice
Avenue Historic District. It is a two-story historic pre-fabricated house purchased in 1917 and built in 1920 by the owner.
It is a semi-bungalow with a craftsman style influence. It has a characteristic front gabled roof, shed dormer type upper
windows and glass panes in the upper portions. The original house contained an enclosed front porch and a rear porch
which was added/removed during the 1940’s. The house is an Aladdin pre-cut house, purchased in 1917 during WWI
when lumber for building was scarce. Walter Brewster Jones, the original owner/builder, as a bookkeeper/office
manager for George Hyde Company, later the Sunsweet Corporation in Campbell* (descriptions excerpted from
attached DPR). The original home may have looked somewhat like this:
Owner’s Authorization
I hereby authorize the City of Campbell to process this application, and I authorize the City of Campbell to enter upon
the property described herein as reasonably necessary to evaluate the project. I have completed or reviewed this
application and any “Supplements to Application” forms and know that the contents there of are true and accurate to
my own knowledge and I assume all responsibility for their accuracy.
Property Owner’s Signature_____________________________________Date:___________________
Staff Use
Assigned Case No: _________________________________________Zone Designation: ______________
Assigned Planner: _________________________________ General Plan Designation: _______________
sume all responsibilility for their a
___________________________________________________
Staf
2/12/2021
Attachment 1(h)
Attachment 2(a)
Attachment 2(b)
Attachment 2(c)
DPR 523A (1/95) *Required information
Page 1 of 2 *Resource Name or #: Laura Campbell Swope House P1. Other Identifier: Campbell Landmark
*P2. Location: Not for Publication _ Unrestricted *a. County Santa Clara and (P2c, P2e, and P2b or P2d. Attach a Location Map as necessary.) *b. USGS 7.5' Quad Date T; R ; ¼ of ¼ of Sec ; B.M. c. Address 73 S. First St. City Campbell Zip 95008 d. UTM: (Give more than one for large and/or linear resources) Zone , mE/ mN e. Other Locational Data: (e.g., parcel #, directions to resource, elevation, etc., as appropriate) APN: 412-06-039 *P3a. Description: (Describe resource and its major elements. Include design, materials, condition, alterations, size, setting, and boundaries) One story wood frame construction with an off-set gable roof. Asphalt green roofing showing wear near front edge overhanging covered wooden porch. Floor of the porch is sagging toward the front. Three wooden posts support the porch. Bay with two sash windows, in front. Carved wooden ornamentation attached over the corners of the bay windows. Diamond shaped wooden strips decorate the front section of the triangular gable. *P3b. Resource Attributes: (List attributes and codes)
*P4. Resources Present: _ Building Structure Object Site District Element of District
Other (Isolates, etc.)
P5b. Description of Photo: (view,
date, accession #) Front
Façade, 07/17/07
*P6. Date Constructed/Age and
Source:
_ Historic Prehistoric
Both
_1895_____________________
*P7. Owner and Address:
Mark & Edna Stevenson
154 Senter Road
San Jose, CA 95111
*P8. Recorded by: (Name,
affiliation, and address)
Maureen Kluska
City of Campbell
71 N. First St.
*P9. Date Recorded: 6/1985
*P10. Survey Type: (Describe)
*P11. Report Citation: (Cite
survey report and other
sources, or enter "none.")
Survey 1977-78. Initial notes
taken by Mark R. Hoke (October
22, 1977).
*Attachments: _NONE Location Map Continuation Sheet Building, Structure, and Object
Record Archaeological Record District Record Linear Feature Record Milling Station
Record Rock Art Record Artifact Record _Photograph Record Other (List):
State of California — The Resources Agency Primary #
DEPARTMENT OF PARKS AND RECREATION HRI #
PRIMARY RECORD Trinomial
NRHP Status Code
Other Listings
Review Code Reviewer Date
P5a. Photograph or Drawing (Photograph required for
buildings, structures, and objects.)
Attachment 2(d)
DPR 523A (1/95) *Required information
*NRHP Status Code
Page 2 of 2 *Resource Name or # (Assigned by recorder)
B1. Historic Name: Laura Campbell Swope House
B2. Common Name: Laura Campbell Swope House
B3. Original Use: Residential B4. Present Use: Residential
*B5. Architectural Style: Queen Anne Victorian Cottage
*B6. Construction History: (Construction date, alterations, and date of alterations)
Built, 1895.
*B7. Moved? _ No Yes Unknown Date: Original Location:
*B8. Related Features: Garage
B9a. Architect: Unknown b. Builder: George Whitney
*B10. Significance: Theme Exploration/Settlement Area
Period of Significance Property Type Applicable Criteria
(Discuss importance in terms of historical or architectural context as defined by theme, period,
and geographic scope. Also address integrity.)
Built for daughter of William Swope and Laura Campbell Swope. Sold to Spiegle family about
1915.
B11. Additional Resource Attributes: (List attributes and codes)
*B12. References:
B13. Remarks:
*B14. Evaluator: See P8
*Date of Evaluation: See P9
State of California — The Resources Agency Primary #
DEPARTMENT OF PARKS AND RECREATION HRI#
BUILDING, STRUCTURE, AND OBJECT RECORD
(This space reserved for official comments.)
Attachment 2(e)
Attachment 2(f)
Attachment 2(g)
Attachment 3(a)
Attachment 3(c)
DPR 523A (1/95) *Required information
Page 1 of 2 *Resource Name or #: Doc and Cora Beal House P1. Other Identifier: Campbell Historic District Property
*P2. Location: Not for Publication _ Unrestricted *a. County Santa Clara and (P2c, P2e, and P2b or P2d. Attach a Location Map as necessary.) *b. USGS 7.5' Quad Date T; R ; ¼ of ¼ of Sec ; B.M. c. Address 81 Alice Ave. City Campbell Zip 95008 d. UTM: (Give more than one for large and/or linear resources) Zone , mE/ mN e. Other Locational Data: (e.g., parcel #, directions to resource, elevation, etc., as appropriate) APN: 412-05-063 *P3a. Description: (Describe resource and its major elements. Include design, materials, condition, alterations, size, setting, and boundaries) Historic Single-Family Residence. One story wood frame with stucco finish. False front. Slightly hipped front gable, with decorative planter motif. Red tiled, flat roof, molded cornice beneath eaves. *P3b. Resource Attributes: (List attributes and codes) 02- Single Family Residence
*P4. Resources Present: _ Building Structure Object Site District Element of District
Other (Isolates, etc.)
P5b. Description of Photo: (view,
date, accession #) Front
Façade, 07/09/07
*P6. Date Constructed/Age and
Source: _ Historic
Prehistoric
Both 1926 *P7. Owner and Address: Bert and Elizabeth Legg 81 Alice Avenue Campbell, CA 95008 *P8. Recorded by: (Name, affiliation, and address) Peggy Coats City of Campbell 70 N. First Street Campbell, CA 95008 *P9. Date Recorded: March, 1986 *P10. Survey Type: (Describe) Inventory Update *P11. Report Citation: (Cite survey report and other sources, or enter "none.") 1977-78 Survey
*Attachments: NONE Location Map Continuation Sheet _ Building, Structure, and Object Record
Archaeological Record District Record Linear Feature Record Milling Station Record Rock
Art Record
Artifact Record Photograph Record Other (List):
State of California — The Resources Agency Primary #
DEPARTMENT OF PARKS AND RECREATION HRI #
PRIMARY RECORD Trinomial
NRHP Status Code
Other Listings
Review Code Reviewer Date
P5a. Photograph or Drawing (Photograph required for
buildings, structures, and objects.)
Attachment 3(d)
DPR 523A (1/95) *Required information
*NRHP Status Code
Page 2 of 2 *Resource Name or # (Assigned by recorder)
B1. Historic Name: Doc and Cora Beal House
B2. Common Name:
B3. Original Use: Single-Family Home B4. Present Use: Same
*B5. Architectural Style: California Bungalow
*B6. Construction History: (Construction date, alterations, and date of alterations)
Estimated to be Built, 1926.
*B7. Moved? _ No Yes Unknown Date: Original Location:
*B8. Related Features:
B9a. Architect: unknown b. Builder: unknown
*B10. Significance: Theme Economic/Industrial Area
Period of Significance Property Type Residence
Applicable Criteria
(Discuss importance in terms of historical or architectural context as defined by theme, period,
and geographic scope. Also address integrity.)
Alice Avenue was created in 1915 on a portion of the site of the fruit drying yards owned by
the George E. Hyde Company, a canning and fruit dehydrating plant occupying 17 acres in
Campbell. The land was originally owned and utilized by Flamming’s Fruit Dryer (1887); sold
to Frank Buxton’s Dryer (1890, and again sold to Campbell Fruit Grower’s Union (1892) which
owned and controlled the drying yards and packing house until its sale to George Hyde in
1909. The residential subdivision, “Hyde Residential Park” was built primarily for housing
cannery workers, though George and Alice Hyde (the Street’s namesake) resided there too.
“Doc” Beal operated a drug store in Campbell, in the B.O. Curry Bldg. Downtown.
B11. Additional Resource Attributes: (List attributes and codes)
*B12. References:
See P11
B13. Remarks:
*B14. Evaluator: See P8
*Date of Evaluation: See P9
State of California — The Resources Agency Primary #
DEPARTMENT OF PARKS AND RECREATION HRI#
BUILDING, STRUCTURE, AND OBJECT RECORD
(This space reserved for official comments.)
Attachment 3(e)
Attachment 3(f)
VSDDGFIGFIGFI220GGFIMSPCGFIWSDSDSDCMDGFIWPGFIWPGGFIVSDSHVSDDSDCMSDGFIDSHWPSDDVSDVSG220GFIVSGFIWPDIMENSION ASNOTED ON PLANPOST IN WALL ASSHOWN ON PLANSUBFLOOR4x6 PIER POSTSIMPSON PB443-#4 BARS EACH WAY8"12"10" SQ.18" MIN. INTOUNDISTURBEDSOILLSTA18 STRAPCONECTING POSTABOVE TO PIER POST2x6 BLOCKING BETWEENADJACENT GIRDERS ORJOISTS WITH 3-16dNAILS TO PIER POSTMASTERBEDROOMEXISTING FIRST FLOOR PLANBATH 2CLOENTRYLIVING RMBEDROOM 3UPKITCHEN CLO.EXISTING SECOND FLOOR PLAN1/8"=1'-0"FIRST FLOOR PLAN 1/4"=1'-0"0 5 10 15 20 25SECOND FLOOR PLAN 1/4"=1'-0"0 5 10 15 20 251/8"=1'-0"NOOKLAUNDRYCLOCLOHALLDINING RMBEDROOM 2BATH 1CLOCLOSTAIR HALLSHEETSSHEETOFSCALE:DATE:DRAWN:JOB:PERMIT SETCONSTRUCTION SETPRELIMINARY SETPLAN CHECK SETDESIGN REVIEW SETREVISIONSBYA R C H I T E C T CHRIS SPAULDING(510) 527-5997 FAX (510) 527-5999BERKELEY CALIFORNIA 94710801 CAMELIA STREET SUITE EDRAWINGS PREPARED BYCAMPBELL CALIFORNIA204 ALICE AVECS/DBKOVACS - JASINSKY3-14-192KOVACS & JASINSKY RESIDENCE AS NOTEDPROPOSED INTERIOR REMODEL 5-14-19 DB4-13-20 Reduce Scope DB2A1[E] BEDROOM 3ENTRY[E] CLO[E] CLO[N] FAU[E] BA 3[E] HALLMUD ROOMKITCHENLIVING ROOMDININGROOMBEDROOM 2[E] MASTERBEDROOM'HERS'CLOMA.BATHSTAIRHALL'HIS' CLO21x27"OPERABLESKYLIGHT26 68DN 112" MAXFROM TOP OFTHRESHOLD3'-0" MINCONC.LANDING,TYPICALEEEXISTING WINDOW TO REMAINEXISTING DOOR TO REMAINL E G E N DINDICATES EXISTING WALLTO BE REMOVEDINDICATES EXISTINGWALL TO REMAININDICATES NEWCONSTRUCTION26 68 28 68 DN24 68 CASEDOPENING(2) 30 30 30 30 30 45 30 45 30 45 30 45 30 30 (2) 26 45 (2) 26 45 28 68 DR W/GLASS LITE50 68 FRENCH DRS30 68 SOLID DR30 45 30 45 26 45 26 45 30 30 26 45 26 45 3'-4"7'-1"3'-4" ±7'-0"2'-5"4'-7" ±ALIGN TO WALLON OTHER SIDE2'-6"DWSINK W/DISPOSER36" RANGE& HOOD W/FAN & LIGHT36" REFR.UP28 68 WOOD FRAMING members shall be Douglas Fir-Larch of the following grades:CLASSIFICATION GradeBlocking, bridging No.3Studs, sills, plates, rafters, joists No.2Posts, beams, headers, girders No.1WOOD FRAMING members shall be Douglas Fir-Larch #1 grade for 4X and larger membersand #2 grade for 3X and smaller members. Lumber shall be stamped S-Dry (19% maximummoisture content)BLOCKING AND BRIDGING shall conform to the requirements of the 2016 CaliforniaResidential Code.NAILING shall be in accordance with Table 2304.9.1 for framing, Table 2511.3.1 for lathand Table 2508.5 for sheet rock of the 2016 California Building Code unless otherwisecalled out on the plans. All nails into pressure treated lumber should be Hot-dippedGalvanized or stainless steel.GYPSUM BOARD shall be US. Gypsum "sheet rock" or equivalent. Nailing shall be inaccordance with 2016 California Residential Code.WOOD CONNECTORS shall be Simpson Company "Strong Tie" connectors or equal. Usecommon nails unless otherwise allowed in Simpson Catalog. All bolts, washers & connectorsin contact with pressure treated lumber shall be hot-dipped galvanized.STRUCTURAL NOTES & SPECIFICATIONSP&SVERIFY THERE'S SMOKEDETECTOR IN EA. [E]BEDROOMS & HALLWAYSGIVING DIRECT ACCESSTO BEDROOMS. ADD [N]IF NONE, AND ADD [N]CARBON MONOXIDEALARM IN HALLWAYONLYN O T E :- ALL [E] ELECTRICAL OUTLET TOBE RE-LOCATED AS SHOWN'- [E] LIGHTING TO REMAINTILEDSHOWER[E]SLOPE(DN)CEILING[E] SLOPE(DN) CEILING[E] SLOPE(DN) CEILING24 68 P&S[E]STAIRVERIFY THERE'S SMOKEDETECTOR IN EA. [E]BEDROOMS & HALLWAYSGIVING DIRECT ACCESS TOBEDROOMS. ADD [N] IFNONE, AND ADD [N] CARBONMONOXIDE ALARM INHALLWAY ONLY[N] 4x4 POSTTO [N] FOOTING[N] 4 x 12 HDR[N] 28 x 28 x18 " DEEPFOOTING1A2F L O O R P L A N N O T E SLIGHTING NOTES1. All lighting shall be high efficacy (i.e. pin-basedCFL; pulse-start MH, HPS, GU-24 socketsother than LEDs, LED luminaires with integralsource, etc.). CEC Table 150.0-A[JA8-compliant] luminaires, controlled bydimmers or vacancy sensors, except in closetsless than 70 sq. ft. and luminaires in hallway.2. In bathrooms, garages, laundry rooms, andutility rooms, at least one luminaire must becontrolled by a vacancy sensor.3. Undercabinet lighting must be switchedseparately from other lighting systems.4. Luminaires providing outdoor lighting andpemanently mounted to a residential buildingor to other buildings on the same lot shall behigh efficacy luminaires (not including lightingaround swimming pools/water features or otherArticle 680 locations) and controlled byeither;- A manual ON and OFF switch that does notoverride to ON the automatic actions ofthe below;- Photocell and motion sensor.- Photo control and automatic time switchcontrol. Controls that override to ON shallnot be allowed unless the override shallautomatically return the photocontrol andautomatic time switch control to its normaloperation within 6 hours- Astronomical Time Clock. Controls thatoverride to ON shall not be allowed unlessthe override shall automatically return theastronomical clock to its normal operationwithin 6 hours and which is programmed toautomatically turn the outdoor lighting OFFduring daylight hours- Energy management control system whichmeets all of the following requrements: At aminimum provides the functionality of anastronomical time clock (in accordance withSection 110.9 2016 Building EnergyEfficiency Standards); meets the InstallationCertification requirements in Section130.4; does not have an override orbypass switch that allows the luminaire tobe always ON; and, is programmed toautomatically turn the outdoor lighting OFFduring daylight hours.NOTE: OUTDOOR LIGHTING SHALL BEDOWNWARD FACING5. Recessed luminaires in insulated ceilings shallbe IC rated, w/ electronic ballast and Air-tight(AT)6. Permanently installed night lights and nightlights integral to installed luminaires or exhaustfan shall not consume more than 5 watts perluminaire/exhaust fan.SHOWER VALVES1. Showers, tubs, whirlpool tubs, and tub-showercombinations shall be provided with individualpressure balance or thermostatic mixingcontrol valves.2. The maximum mixed water setting shall be 120°Fahrenheit.3. Water heater thermostat shall not beconsidered as suitable for meeting thisrequirement.FAN*MANUAL-ON VACANCY SENSOR THAT TURNS FIXTURE OFF AUTOMATICALLY WHEN NOOCCUPANTS ARE PRESENT & WHICH DOES NOT HAVE AN OVERRIDE ALLOWING THEFIXTURE TO BE ALWAYS ONCEILING MOUNTED FIXTURERECESSED FIXTUREWALL MOUNTED FIXTURELED STRIP-LIGHT (UNDER CAB)E L E C T R I C A L / M E C H A N I C A L L E G E N D*NOTE: ALL LIGHT FIXTURES SHALL BE HIGH EFFICACY LEDSWITCHSWITCH WITH VACANCY SENSOR*SWITCH WITH DIMMEROUTLET220V OUTLETGAS CONNECTIONWATER CONNECTIONHOSE BIBVSD220GHBWSMOKE DETECTORCARBON MONOXIDE ALARMSHOWER HEADWATER PROTECTIONSDSHCMWPGROUND FAULT INTERRUPTERGFIMOTION SENSORMSPHOTOCELLPCEGRESSEGRESSMECHANICAL AND PLUMBING NOTES1. Installation instructions for all listed equipment shall beprovided to the field inspector at time of inspection.2. Dryer exhaust shall be smooth metal duct extending toexterior with backdraft damper.3. All exterior hose bibs shall have non-removablebackflow prevention devices.4. Water heater shall have a pressure-relief valve withdrain to exterior.5. Provide a minimum 3" working space along each side(with a total of at least 12" on both sides combined),back and top of furnace.6. All building water supply systems in which quick-actingvalves are installed shall be provided with devices toabsorb high pressures resulting from the quick closingof these valves (e.g., clothes washers anddishwashers).7. Termination of all environmental air ducts shall be aminimum of 3 feet from any openings into the building(i.e., dryers, bath and utility fans, etc., must be 3 feetaway from doors, windows, opening skylights or atticvents).8. All mechanical, plumbing, electrical, and similarpenetrations of the floor or top-plates shall be caulkedwith a rated fire caulk with an ASTM E136 rating.9. Minimum recovery capacity of water heater equivalentto not less than the first hour rating of 80 gallons.10. Install recessed washer & dryer hook-ups to allow forunits to be flush with rear wall.11. Ventilation heating and air conditioning systems shallhave MERV 6 filters or better.12. Local exhaust systems shall vented to the outdoors forbathrooms.13. Provide minimum 50 cfm intermittent airflow forBathroom exhaust fans, OR provide minimum 20 cfmfor continuously operating Bathroom exhaust fans.14. Water piping and cooling system line insulationthickness and conductivity Piping shall be insulated tothe thickness as follows:a. All domestic hot water system piping conditionslisted below, whether buried or unburied, must beinsulated and the insulation thickness shall beselected based on the conductivity range in Table120.3-A and the insulation level shall be selectedfrom the fluid temperature range based on thethickness required in Table 120.3Ab. The first 5' of hot and cold-water pipes from thestorage tank.c. All water piping of nominal 34" diameter or larger.d. All piping associated with a domestic hot waterrecirculation system regardless of diametere. Piping from the heating source to a storage tank orbetween tanksf. Piping buried below grade15. No domestic dishwashing machine shall be directlyconnected to a drainage system or food waste disposerwithout the use of an approved dishwasher air gap fitting onthe discharge side of the dishwashing machine. Listed airgaps shall be installed with the flood-level (FL) marking at orabove the flood level of the sink or drain-board, whicheveris higher.16. All exhaust fans shall be ENERGY STAR compliant andprovided with humidity controls adjusting from 50% -80%. All exhaust fans to have backdraft dampers.SMOKE AND CARBON MONOXIDE ALARMS1. A smoke detectors and carbon monoxide alarms shallbe hard-wired with battery back-up and interconnectedsuch that when one alarm sounds, all will sound.GENERAL NOTES1. All showers to have a minimum clear door opening width of 22"2. All showers to have tile wall protection to a minimum of 84" abovethe floor-mount tile on full mortar bed or ½" cement backer board.3. Wooden backing (2x8 min.) shall be provided in all bathroom wallsat toilet, shower, and bathtub- located at 34" from the floor to thecenter of the backing, suitable for the addition of grab bars.WATER HEATER NOTES1. A 120V electrical receptacle shall be wintin 3' of the water heaterand accessible to the water heater with no obstructions.2. A category III or IV vent, or a type B vent with straight pipe shall be provided between the outside terminationand the space where the water heater is installed3. A condensate drain shall be installed that is no more than 2" higherthan the base of the installed water heater, and allows naturaldraining without pump assistance.4. The water heater shall have a gas supply line capable of providing200,000 BTU/hr.5. If the water heater is installed in an attic, attic-ceiling, floor ceilingassembly, or floor-subfloor assembly where damage results from aleaking water heater, a water tight pan of corrosion resistantmaterials shall be installed beneath the water heater with not lessthan 34 of an inch diameter drain to an approved location.WATER HEATER SEISMIC ANCHORING1. Straps shall be at the upper one-third and lower one-third of itsvertical dimensions.2. At lower point, maintain a minimum of four inches above thecontrols with the strapping.ELECTRICAL NOTES1. The required two small appliance branch circuits for the kitchen arelimited to supplying wall and counter space outlets (note theycannot serve the dining room, outside plugs, range hoods,disposals, dishwashers, or microwaves- only the requiredcountertop/wall outlets including the refrigerator).2. Light fixtures in tub and shower enclosures shall be listed (andlabeled) as "suitable for damp locations".3. All branch circuits that supply outlets installed in dwelling unit kitchens,family rooms, dining rooms, living rooms, parlors, libraries, dens,bedrooms, sunrooms, recreations rooms, closets, hallways, laundryareas, or similar rooms or areas shall be protected by an arc-fault circuitinterrupter4. A dedicated 30 amp branch circuit shall be provided to supply thelaundry receptacle outlet.5. A dedicated 20-amp circuit is required to serve bathroom outlets.This circuit cannot supply any other receptacles, lights, fans, etc.(exception: where the circuit supplies a single bathroom, outletsfor other equipment within the same bathroom shall be permittedto be supplied).6. All 125-volt, 15- and 20- ampere receptacle outlets shall belisted as Tamper-resistant receptacles.7. Provide the following separate circuits:a) 20 amps for the bathroomb) (2) small appliance circuits for the kitchen 20 ampc) Motor (FAU)d) Garbage disposale) Dishwasherf) 20 amp laundry circuitg) Dryer 30 amp minimum 220vh) EV charger (no other outlets)i) Separate circuit in the garage8. Provide GFCI protection at the following locations: - within 6' of the edge of a shower or tub - laundry areas - dishwashers - garage receptacles (min. one for each stall) - kitchens and at all counters with sinks - bathroomsPIER POST FOOTINGNTS1A1PROJECT ADDRESS: 204 ALICE AVE, CAMPBELL, CAOWNER'S NAME: KORNEL KOVACS & MARIE JASINSKYPROJECT DESCRIPTION:- INTERIOR REMODEL OF [E] 2-STORY HOUSE. TOTALREMODELED AREA = 390 ± SQ.FT.- CONVERT 15 SQ.FT. OF [E] ATTIC SPACE INTOMASTER'S CLOSET & LAUNDRY CLO. ( [N] LIVING AREA )- NO TREE AFFECTED / BEING REMOVED BY THE SCOPEOF WORK OF THIS PROJECTAPN: 412-04-069ZONING: R-1-6TYPE OF CONSTRUCTION: V-B, NON-SPRINKLEREDOCCUPANCY GROUP: R-3 / ULOT SIZE: 16,570 SQ.FT. ± § 0.38 ACREFLOOR AREA OF MAIN HOUSE[E] 1ST FLR 999[E] 2ND FLR 712.42ND FLR ADDITION 7.3 SUBTOTAL1,718.7 § 1,719P R O J E C T D A T AThe contractor shall furnish all material, labor,scaffolding, utensils, and apparatus required for thework shown on these plans and pay for the fullfreightage cartage, taxes, and handling of materialassociated with the work.All work shall comply and conform to all codes andregulations, including the 2016 CBC, CMC, CPC, CEC,CRC, & CAL Green, & 2016 California Energyrequirements, and all local, state and federalrequirements, codes and regulations, unless otherwisenoted.Contractor shall be solely responsible for job andworksite safety.All work is to be performed in accordance with theseplans and specifications and to the satisfaction of theowner.Bidders shall visit the site and familiarize themselveswith all existing conditions, and be prepared to carryout the work within the existing limitations.Verify all dimensions in the field, written dimensionshave precedence over scaled dimensions. Anydiscrepancies between drawings and/or specificationsand actual conditions shall be brought to the attentionof the architect for immediate clarification prior toproceeding with the work.Change orders shall be in writing.Substitutions will be considered, but do not substitutematerials, equipment, or methods without specificadvanced approval by the architect.Contractor shall notify the architect of all modificationsto drawing by the building department and of allchanges requested by the inspector.Follow manufacturer's instructions carefully.Manufacturer's operating instructions and guaranteesshall be given to the owner at the end of the job.All features of construction not fully shown shall be ofthe same type and character as that shown for similarconditions. For special conditions or discrepancies,notify the architect before bidding or proceeding withwork.All material shall be of the best of their respectivekinds, new, and subject to the approval of the owner.All work is to be performed in the best manner byskilled workmen.It is the responsibility of the contractor &sub-contractors to notify the architect and/or engineerof any discrepancies, inconsistencies, errors oromissions in the plans & specifications which mightaffect the work, prior to proceeding with the work.G E N E R A L N O T E SSHEET A1 PROJECT DATA, [E] & PROPOSED FLOORPLANS, VICINITY MAP, GENERAL & FLOOR PLANNOTES & DETAILSSHEET A2 ELEVATIONSSHEET A3 TITLE 24 CERTIFICATED R A W I N G I N D E XNo grading is required for this project except forfoundation excavationsExisting drainage pattern to remainAny new downspouts to discharge across pavements &splashblocks & into landscaped areas, away from structures.Water shall not be allowed to pond adjacent to foundationsGRADING & DRAINAGE NOTESPORCH[E] PORCHEEEEEEV I C I N I T Y M A P50 68 FRENCH DRSW/ TEMPGLASS[N] 28 x 28 x 18 "DEEP FOOTINGUNDER [E] FOOTING[E][E]NOTE:REPLACE ALL [E] WINDOWSIN [E] OPENINGSN O T E :- ALL [E] ELECTRICAL OUTLET TOBE RE-LOCATED AS SHOWN'- [E] LIGHTING TO REMAINN O T E :- ALL [E] ELECTRICAL OUTLET TOBE RE-LOCATED AS SHOWN'INSTALL [N] ELEC. OUTLET &TV + INTERNET HOOK-UPSABOVE FIREPLACE'S MANTEL[N]- Walls opened during construction shall be insulated toR-15- Ceilings opened during construction shall be insulated toa minimum of R-22- New windows and glass doors shall have a maximumU-value of 0.32 and a maximum SHGC of 0.25E N E R GY N O T E S- All windows to be replaced.- Front windows to be MARVIN wood frame windows with78" simulated divided lites- All other windows to be MARVIN 'ELEVATE' windows anddoors w/ 78" simulated divided litesWINDOW REPLACEMENT NOTESNOTE:ADD PROPERTY LINESEWER CLEANOUT PERSANITARY DISTRICTREQUIREMENTS[E] ATTICACCESSTO REMAIN(2) 29"x5212" DH'MARVIN' , WOOD FRAME(2) 29"x5212" DH'MARVIN' , WOOD FRAME3812"x5614" DHNOTES:ALL SINK FAUCETS, SHOWER HEADS, TOILETS AND URINALSSHALL COMPLY WITH CALIFORNIA CIVIL CODE SECTION 1101.1THROUGH 1101.8- KITCHEN FAUCETS SHALL NOT EXCEED 1.8 GALS/MIN- LAVATORY FAUCETS SHALL NOT EXCEED 1.2 GALS/MIN- SHOWER HEADS SHALL NOT EXCEED 1.8 GALS/MIN- TOILETS SHALL NOT EXCEED 1.28 GALS/FLUSH- URINALS SHALL NOT EXCEED 0.5 GALS/FLUSH[E] ATTICACCESSTO REMAIN37"x3958"CSMT22[N] WINDOW IN[E] OPENING(SAME SIZE)2WARDROBECAB.24'-10"1'-3"MIN,TYP.ɓ19x32"WALL-MOUNTLAVWALL-HUNG WCTEMP GLASSENCLOSUREINSTALL METAL DRAINPAN BELOW WASHER(DRAIN TO EXTERIOR)WVENT DRYERTO EXTERIORDWALL-HUNGWCCAB.TUB &SHOWERCOMBOP&S2(2) 3812" x 3614 " DH2229"x5212" CSMT'MARVIN' , WOOD FRAMEEGRESS[E] SLOPE(DN) CLG30x30"ATTICACCESSPROVIDE PLYWOODSERVICE PLATFORM,PERMANENT OUTLET& SWITCHED LIGHTAT ACCESSOPENINGELECTRIC HYBRIDWATER HEATER W/SEISMIC STRAPS &DRAIN PAN BELOW21'-6"2229"x5212" CSMT'MARVIN' , WOOD FRAME22EEE28 68 PKT DR237" x 3958"CSMT37"x3558"AWNTEMP GLASS37" x 5558"CSMT2237" x 3558"AWN3812"x5614" DH37"x3558"AWNTEMP GLASS3212" x 5614"DH3212" x 5614"DH23812"x5614" DH2Attachment 3(g)
FRONT (NORTH)ELEVATION 1/4"=1'-0"A2[E] COMP. SHINGLE ROOFING.REAR (SOUTH) ELEVATION 1/4"=1'-0"RIGHT SIDE (WEST) ELEVATION 1/4"=1'-0"LEFT SIDE (EAST) ELEVATION 1/4"=1'-0"SHEETSSHEETOFSCALE:DATE:DRAWN:JOB:PERMIT SETCONSTRUCTION SETPRELIMINARY SETPLAN CHECK SETDESIGN REVIEW SETREVISIONSBYA R C H I T E C T CHRIS SPAULDING(510) 527-5997 FAX (510) 527-5999BERKELEY CALIFORNIA 94710801 CAMELIA STREET SUITE EDRAWINGS PREPARED BYCAMPBELL CALIFORNIA204 ALICE AVECS/DBKOVACS - JASINSKY3-14-192KOVACS & JASINSKY RESIDENCE AS NOTEDPROPOSED INTERIOR REMODEL 5-14-19 DB4-13-20 Reduce Scope DB2[E] HORIZ.SIDING[E] WOODSHUTTERWINDOW NOTE:ALL EXISTING WINDOWS ARE TO BE REPLACED INEXISTING OPENINGS - SEE FLOOR PLANS FORDEATILS222222222222
Attachment 3(h)
Attachment 4(a)
Attachment 4(b)
Attachment 4(c)
DPR 523A (1/95) *Required information
Page 1 of 2 *Resource Name or #: Doc and Cora Beal House P1. Other Identifier: Campbell Historic District Property
*P2. Location: Not for Publication _ Unrestricted *a. County Santa Clara and (P2c, P2e, and P2b or P2d. Attach a Location Map as necessary.) *b. USGS 7.5' Quad Date T; R ; ¼ of ¼ of Sec ; B.M. c. Address 81 Alice Ave. City Campbell Zip 95008 d. UTM: (Give more than one for large and/or linear resources) Zone , mE/ mN e. Other Locational Data: (e.g., parcel #, directions to resource, elevation, etc., as appropriate) APN: 412-05-063 *P3a. Description: (Describe resource and its major elements. Include design, materials, condition, alterations, size, setting, and boundaries) Historic Single-Family Residence. One story wood frame with stucco finish. False front. Slightly hipped front gable, with decorative planter motif. Red tiled, flat roof, molded cornice beneath eaves. *P3b. Resource Attributes: (List attributes and codes) 02- Single Family Residence
*P4. Resources Present: _ Building Structure Object Site District Element of District
Other (Isolates, etc.)
P5b. Description of Photo: (view,
date, accession #) Front
Façade, 07/09/07
*P6. Date Constructed/Age and
Source: _ Historic
Prehistoric
Both 1926 *P7. Owner and Address: Bert and Elizabeth Legg 81 Alice Avenue Campbell, CA 95008 *P8. Recorded by: (Name, affiliation, and address) Peggy Coats City of Campbell 70 N. First Street Campbell, CA 95008 *P9. Date Recorded: March, 1986 *P10. Survey Type: (Describe) Inventory Update *P11. Report Citation: (Cite survey report and other sources, or enter "none.") 1977-78 Survey
*Attachments: NONE Location Map Continuation Sheet _ Building, Structure, and Object Record
Archaeological Record District Record Linear Feature Record Milling Station Record Rock
Art Record
Artifact Record Photograph Record Other (List):
State of California — The Resources Agency Primary #
DEPARTMENT OF PARKS AND RECREATION HRI #
PRIMARY RECORD Trinomial
NRHP Status Code
Other Listings
Review Code Reviewer Date
P5a. Photograph or Drawing (Photograph required for
buildings, structures, and objects.)
Attachment 4(d)
DPR 523A (1/95) *Required information
*NRHP Status Code
Page 2 of 2 *Resource Name or # (Assigned by recorder)
B1. Historic Name: Doc and Cora Beal House
B2. Common Name:
B3. Original Use: Single-Family Home B4. Present Use: Same
*B5. Architectural Style: California Bungalow
*B6. Construction History: (Construction date, alterations, and date of alterations)
Estimated to be Built, 1926.
*B7. Moved? _ No Yes Unknown Date: Original Location:
*B8. Related Features:
B9a. Architect: unknown b. Builder: unknown
*B10. Significance: Theme Economic/Industrial Area
Period of Significance Property Type Residence
Applicable Criteria
(Discuss importance in terms of historical or architectural context as defined by theme, period,
and geographic scope. Also address integrity.)
Alice Avenue was created in 1915 on a portion of the site of the fruit drying yards owned by
the George E. Hyde Company, a canning and fruit dehydrating plant occupying 17 acres in
Campbell. The land was originally owned and utilized by Flamming’s Fruit Dryer (1887); sold
to Frank Buxton’s Dryer (1890, and again sold to Campbell Fruit Grower’s Union (1892) which
owned and controlled the drying yards and packing house until its sale to George Hyde in
1909. The residential subdivision, “Hyde Residential Park” was built primarily for housing
cannery workers, though George and Alice Hyde (the Street’s namesake) resided there too.
“Doc” Beal operated a drug store in Campbell, in the B.O. Curry Bldg. Downtown.
B11. Additional Resource Attributes: (List attributes and codes)
*B12. References:
See P11
B13. Remarks:
*B14. Evaluator: See P8
*Date of Evaluation: See P9
State of California — The Resources Agency Primary #
DEPARTMENT OF PARKS AND RECREATION HRI#
BUILDING, STRUCTURE, AND OBJECT RECORD
(This space reserved for official comments.)
Attachment 4(e)
Attachment 4(f)